HMGCR Protein, Human (His)

As a key enzyme in cholesterol biosynthesis, HMGCR protein plays a central role in regulating cellular cholesterol levels. It catalyzes the conversion of HMG-CoA to mevalonate, a key step in the synthesis of cholesterol and other isoprenoids. HMGCR Protein, Human (His) is the recombinant human-derived HMGCR protein, expressed by E. coli , with N-6*His labeled tag.

Cyclophilin A protein serves as a catalyst for the cis-trans isomerization of proline imidic peptide bonds within oligopeptides. Beyond its enzymatic role, it exerts diverse cellular effects, including a potent chemotactic influence on leukocytes, mediated in part through the activation of its membrane receptor BSG/CD147, initiating a signaling cascade leading to MAPK/ERK activation. The protein also activates endothelial cells (ECs) in a pro-inflammatory manner, inducing NF-kappa-B and MAP-kinase pathways and promoting the expression of adhesion molecules. Furthermore, Cyclophilin A induces apoptosis in ECs by modulating the expression of key factors involved in chemotaxis and apoptosis. In response to oxidative stress, it initiates both proapoptotic and antiapoptotic signaling in ECs, highlighting its multifaceted role. The protein negatively regulates MAP3K5/ASK1 kinase activity and is crucial for the assembly of TARDBP in heterogeneous nuclear ribonucleoprotein complexes, influencing TARDBP binding to RNA and regulating the expression of associated genes. Additionally, Cyclophilin A plays a significant role in platelet activation and aggregation, as well as in the regulation of calcium mobilization and integrin ITGA2B:ITGB3 bidirectional signaling through increased ROS production and facilitation of integrin-cytoskeleton interaction. It also exhibits binding affinity for heparan sulfate glycosaminoglycans.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

N-6*His

P04035-1 (M588-T887)

3156  [NCBI]

Partial

MTRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTSIAGRNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKSVVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGHLVKSHMIHNRSKINLQDLQGACTKKT

Approximately 38 kDa

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.