HMGCR Protein, Human (His)

2 Cited Publications
Customer Review

Based on 2 publication(s) in Google Scholar

As a key enzyme in cholesterol biosynthesis, HMGCR protein plays a central role in regulating cellular cholesterol levels. It catalyzes the conversion of HMG-CoA to mevalonate, a key step in the synthesis of cholesterol and other isoprenoids. HMGCR Protein, Human (His) is the recombinant human-derived HMGCR protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

As a key enzyme in cholesterol biosynthesis, HMGCR protein plays a central role in regulating cellular cholesterol levels. It catalyzes the conversion of HMG-CoA to mevalonate, a key step in the synthesis of cholesterol and other isoprenoids. HMGCR Protein, Human (His) is the recombinant human-derived HMGCR protein, expressed by E. coli , with N-6*His labeled tag.

Background

Cyclophilin A protein serves as a catalyst for the cis-trans isomerization of proline imidic peptide bonds within oligopeptides. Beyond its enzymatic role, it exerts diverse cellular effects, including a potent chemotactic influence on leukocytes, mediated in part through the activation of its membrane receptor BSG/CD147, initiating a signaling cascade leading to MAPK/ERK activation. The protein also activates endothelial cells (ECs) in a pro-inflammatory manner, inducing NF-kappa-B and MAP-kinase pathways and promoting the expression of adhesion molecules. Furthermore, Cyclophilin A induces apoptosis in ECs by modulating the expression of key factors involved in chemotaxis and apoptosis. In response to oxidative stress, it initiates both proapoptotic and antiapoptotic signaling in ECs, highlighting its multifaceted role. The protein negatively regulates MAP3K5/ASK1 kinase activity and is crucial for the assembly of TARDBP in heterogeneous nuclear ribonucleoprotein complexes, influencing TARDBP binding to RNA and regulating the expression of associated genes. Additionally, Cyclophilin A plays a significant role in platelet activation and aggregation, as well as in the regulation of calcium mobilization and integrin ITGA2B:ITGB3 bidirectional signaling through increased ROS production and facilitation of integrin-cytoskeleton interaction. It also exhibits binding affinity for heparan sulfate glycosaminoglycans.

Verified Bioactivity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • HMGCR (M588-T887)
      Accession # P04035-1
    • C-term
  • Protein Length

    Partial

  • Synonyms

    HMGCR; 3-Hydroxy-3-Methylglutaryl Coenzyme A Reductase; 3-Hydroxy-3-Methylglutaryl-CoA Reductase; Hydroxymethylglutaryl-CoA Reductase (NADPH); 3-Hydroxy-3-Methylglutaryl-Coenzyme A Reductase; Alternative Protein HMGCR; HMG-CoA Reductase; LGMDR28; 3-Hydrox

  • AA Sequence

    MTRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTSIAGRNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKSVVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGHLVKSHMIHNRSKINLQDLQGACTKKT

  • Predicted Molecular Mass

    36 kDa

  • Molecular Weight

    Approximately 38 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00