HMGN3 Protein, Human (His)
Based on 1 Customer Validation
HMGN3 binds to nucleosomes, regulates chromatin structure, and affects chromatin-dependent processes such as transcription and DNA repair. It affects insulin and glucagon levels and regulates pancreatic gene expression related to insulin secretion. HMGN3 Protein, Human (His) is the recombinant human-derived HMGN3 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
HMGN3 binds to nucleosomes, regulates chromatin structure, and affects chromatin-dependent processes such as transcription and DNA repair. It affects insulin and glucagon levels and regulates pancreatic gene expression related to insulin secretion. HMGN3 Protein, Human (His) is the recombinant human-derived HMGN3 protein, expressed by E. coli , with N-His labeled tag.
Background
HMGN3, a protein with the capability to bind to nucleosomes, exerts regulatory control over chromatin structure, thereby influencing various chromatin-dependent processes, including transcription, DNA replication, and DNA repair. It plays a role in the modulation of insulin and glucagon levels and participates in the regulation of pancreatic genes involved in insulin secretion. HMGN3 specifically binds to the promoter region of the glucose transporter SLC2A2, recruiting transcription factors such as PDX1, thereby impacting glucose homeostasis. Additionally, it regulates the expression of SLC6A9, a glycine transporter crucial for maintaining glycine concentration in synaptic junctions within the central nervous system. Beyond its metabolic functions, HMGN3 may also contribute to ocular development and astrocyte function. Furthermore, HMGN3 engages in interactions with the ligand binding domain of the thyroid receptor, requiring the presence of thyroid hormone for its activity, and interacts with the transcriptional regulator SEHBP, highlighting its multifaceted roles in cellular and physiological processes.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-10*His
-
Accession
Q15651-2 (M1-N77)
-
Molecular Construction
-
N-term
-
His
-
HMGN3 (M1-N77)
Accession # Q15651-2 -
C-term
-
-
Protein Length
Full Length of Isoform-2
-
Synonyms
HMGN3; Thyroid Receptor-Interacting Protein 7; Prev. TRIP7; PNAS-24; High Mobility Group Nucleosome-Binding Domain-Containing Protein 3; PNAS-25; TR-Interacting Protein 7; TRIP-7; Thyroid Hormone Receptor Interacting Protein 7; High Mobility Group Nucleos
-
AA Sequence
MPKRKSPENTEGKDGSKVTKQEPTRRSARLSAKPAPPKPEPKPRKTSAKKEPGAKISRGAKGKKEEKQEAGKEGTEN
-
Molecular Weight
Approximately 16 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
