1. Recombinant Proteins
  2. Cytokines and Growth Factors Biotinylated Proteins
  3. Interleukin & Receptors
  4. IL-10
  5. IL-10 Protein, Human (Biotinylated, HEK293, His-Avi)

IL-10 Protein, Human (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P78144
Handling Instructions Technical Support

IL-10 protein is a major immunoregulatory cytokine with profound anti-inflammatory functions that limits excessive tissue destruction caused by inflammation. Mechanistically, IL10 binds to its heterotetrameric receptors IL10RA and IL10RB, leading to JAK1- and STAT2-mediated phosphorylation of STAT3, which translocates to the nucleus and drives the expression of anti-inflammatory mediators. IL-10 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived IL-10 protein, expressed by HEK293 , with N-His, N-Avi labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-10 protein is a major immunoregulatory cytokine with profound anti-inflammatory functions that limits excessive tissue destruction caused by inflammation. Mechanistically, IL10 binds to its heterotetrameric receptors IL10RA and IL10RB, leading to JAK1- and STAT2-mediated phosphorylation of STAT3, which translocates to the nucleus and drives the expression of anti-inflammatory mediators. IL-10 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived IL-10 protein, expressed by HEK293 , with N-His, N-Avi labeled tag.

Background

IL-10 Protein, a key immune regulatory cytokine, exerts potent anti-inflammatory effects to prevent excessive tissue damage caused by inflammation. It engages its heterotetrameric receptor, composed of IL10RA and IL10RB, triggering JAK1 and STAT2-mediated phosphorylation of STAT3. This leads to STAT3 translocation into the nucleus, driving the expression of anti-inflammatory mediators. IL-10 Protein targets antigen-presenting cells like macrophages and monocytes, inhibiting the release of pro-inflammatory cytokines. It also hinders antigen presentation by reducing MHC-class II and co-stimulatory molecule expression, thereby dampening T cell activation. Additionally, it reprograms metabolic pathways, including mTOR signaling, to control the inflammatory response of macrophages. The protein forms homodimers and interacts with IL10RA and IL10RB.

Species

Human

Source

HEK293

Tag

N-Avi;N-6*His

Accession

P22301 (S19-N178)

Gene ID
Molecular Construction
N-term
6*His-Avi
IL-10 (S19-N178)
Accession # P22301
C-term
Protein Length

Full Length of Mature Protein

Conjugation

Biotin

Synonyms
Interleukin-10; IL-10; CSIF; IL10A; TGIF; B-TCGF; GVHDS; MGC126450; MGC126451
AA Sequence

SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN

Predicted Molecular Mass
21.3 kDa
Molecular Weight

Approximately 23-28 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by Bis-Tris PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

IL-10 Protein, Human (Biotinylated, HEK293, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

IL-10 Protein, Human (Biotinylated, HEK293, His-Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-10 Protein, Human (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P78144
Quantity:
MCE Japan Authorized Agent: