IL-10 Protein, Human (HEK293, His-Avi)

IL-10 protein is a major immunoregulatory cytokine with profound anti-inflammatory functions that limits excessive tissue destruction caused by inflammation. Mechanistically, IL10 binds to its heterotetrameric receptors IL10RA and IL10RB, leading to JAK1- and STAT2-mediated phosphorylation of STAT3, which translocates to the nucleus and drives the expression of anti-inflammatory mediators. IL-10 Protein, Human (HEK293, His-Avi) is the recombinant human-derived IL-10 protein, expressed by HEK293 , with N-His, N-Avi labeled tag.

IL-10 Protein, a key immune regulatory cytokine, exerts potent anti-inflammatory effects to prevent excessive tissue damage caused by inflammation. It engages its heterotetrameric receptor, composed of IL10RA and IL10RB, triggering JAK1 and STAT2-mediated phosphorylation of STAT3. This leads to STAT3 translocation into the nucleus, driving the expression of anti-inflammatory mediators. IL-10 Protein targets antigen-presenting cells like macrophages and monocytes, inhibiting the release of pro-inflammatory cytokines. It also hinders antigen presentation by reducing MHC-class II and co-stimulatory molecule expression, thereby dampening T cell activation. Additionally, it reprograms metabolic pathways, including mTOR signaling, to control the inflammatory response of macrophages. The protein forms homodimers and interacts with IL10RA and IL10RB.

Human

HEK293

N-Avi;N-6*His

P22301 (S19-N178)

3586  [NCBI]

Full Length of Mature Protein

SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN

Approximately 23-25 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by Bis-Tris PAGE.

<1 EU/μg, determined by LAL method.