IL-12 Protein, Rat (CHO)
Based on 1 Customer Validation
IL-12 Protein, Rat (CHO) is an inflammatory cytokine that promotes the response of the immune system.
- Species: Rat
- Source: CHO
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
IL-12 Protein, Rat (CHO) is an inflammatory cytokine that promotes the response of the immune system.
Background
Interleukin-12 is a heterodimeric inflammatory cytokine. Interleukin-12 is a potent cytokine that plays an important role in regulating the response of the adaptive immune system by driving the differentiation of naive T-cells to Th1 cells, which is important for protection against intracellular pathogens[1].
Verified Bioactivity
The ED50 is <0.1 ng/mL as measured by 2D6 cells.
Technical Parameters
-
Species Rat
-
Source CHO
-
Tag Tag Free
-
Molecular Construction
-
N-term
-
Il12a (R23-S215)
Accession # Q9R103 -
C-term
-
N-term
-
Il12b (M23-S335)
Accession # E9PU71 -
C-term
-
-
Synonyms
IL12A; Cytotoxic Lymphocyte Maturation Factor 1, P35; Prev. NKSF1; NK Cell Stimulatory Factor Chain 1; IL-12A; Interleukin-12 Alpha Chain; Interleukin-12 Subunit Alpha; Interleukin 12, P35; CLMF; IL-12, Subunit P35; NFSK; IL35 Subunit; P35; CLMF P35; Inte
-
AA Sequence
p35:
RVIPVSGPAKCLNQSQNLLKTTDDMVRTAREKLKHYSCTAGDIDHEDITRDKTSTLEACLPLELHKNESCLATKETSSIIRGSCLPPQKTSLMMTLCLGSIYEDLKMYQSEFQAINAALQSHNHQQITLDRNMLMAIDELMRSLNHSGETLHQKAPMGEADPYRVKMKLCILLHAFSTRVMTINRVMNYLSSSHHHHHH
p40:
MWELEKDVYVVEVDWRPDAPGETVTLTCDSPEEDDITWTSDQRRGVIGSGKTLTITVREFLDAGQYTCHRGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVHRNTDLKFNIKSSSSSPESRAVTCGRASLSAEKVTLNQRDYEKYSVACQEDVTCPTAEETLPIELVVEAQQQNKYENYSTSFFIRDIIKPDPPKNLQVKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKTKETEEECNQKGAFLVEKTSAEVQCKGANICVQAQDRYYNSSCSKWTCVPCRGRS -
Molecular Weight
Approximately 26-28 kDa (p35) & 42-45 kDa (p40), based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS.
<0.2 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (264 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
