IL-13 Protein, Human (HEK293, GST)
IL-13 Protein, Human (HEK293, GST) is the recombinant human-derived IL-13 protein, expressed by HEK293, with C-GST tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
IL-13 Protein, Human (HEK293, GST) is the recombinant human-derived IL-13 protein, expressed by HEK293, with C-GST tag.
Background
IL-13 Protein assumes pivotal roles in allergic inflammation and the immune response to parasite infection. It synergizes with IL2 in regulating interferon-gamma synthesis, stimulating B-cell proliferation, and activating eosinophils, basophils, and mast cells. Beyond its immunological functions, IL-13 plays a crucial role in controlling IL33 activity by modulating the production of transmembrane and soluble forms of interleukin-1 receptor-like 1/IL1RL1. It demonstrates the capacity to antagonize Th1-driven proinflammatory immune responses and downregulates the synthesis of various proinflammatory cytokines, including IL1, IL6, IL10, IL12, and TNF-alpha, partly through the suppression of NF-kappa-B. Not confined to hematopoietic cells, IL-13 also acts on nonhematopoietic cells such as endothelial cells, inducing vascular cell adhesion protein 1/VCAM1, which is crucial in the recruitment of eosinophils. Its biological effects are mediated through receptors comprising the IL4R chain and the IL13RA1 chain, activating JAK1 and TYK2, ultimately leading to the activation of STAT6. Besides IL13RA1, another receptor, IL13RA2, acts as a high-affinity decoy for IL-13, mediating internalization and depletion of extracellular IL-13. IL-13 interacts directly with IL13RA2, further illustrating the complexity of its regulatory mechanisms.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-GST
-
Accession
AAK53823.1 (G21-N132)
-
Gene ID3596
-
Molecular Construction
-
N-term
-
IL-13 (G21-N132)
Accession # AAK53823.1 -
GST
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IL13; MGC116789; Interleukin 13; ALRH; IL-13; BHR1; Interleukin-13; Bronchial Hyperresponsiveness-1 (Bronchial Asthma); P600; Allergic Rhinitis; MGC116786; NC30; MGC116788
-
AA Sequence
GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN
-
Predicted Molecular Mass
38.5 kDa
-
Molecular Weight
Approximately 48-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)