IL-16 Protein, Mouse

IL-16 Protein, a cytokine, plays a significant role in immune regulation and inflammation. It modulates the activation and migration of various immune cells, such as T cells and monocytes. Understanding the functions of IL-16 Protein can aid in studying immune responses and developing targeted therapies for inflammatory and autoimmune diseases. IL-16 Protein, Mouse is the recombinant mouse-derived IL-16 protein, expressed by E. coli , with tag free.

IL-16, a multifaceted protein, instigates a migratory response in CD4+ lymphocytes, monocytes, and eosinophils. It plays a pivotal role in priming CD4+ T-cells for responsiveness to interleukin-2 (IL-2) and interleukin-15 (IL-15), concurrently inducing the expression of the interleukin 2 receptor. Additionally, IL-16 serves as a ligand for CD4, fostering intricate interactions. Notably, isoform 1 of IL-16 is proposed to function as a scaffolding protein, providing a structural anchor for ion channels within the cellular membrane.

Measured by its binding ability in a functional ELISA. Immobilized Mouse CD4 (HY-P72904) at 2 μg/mL (100 μL/well) can bind Biotinylated Mouse IL-16. The ED₅₀ for this effect is 153.1 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Mouse CD4 (HY-P72904) at 2 μg/mL (100 μL/well) can bind Biotinylated Mouse IL-16. The ED₅₀ for this effect is 153.1 ng/mL.

Mouse

E. coli

Tag Free

O54824 (S1205-S1322)

16170  [NCBI]

Full Length of Mature Protein

SAASASAASDISVESKEATVCTVTLEKTSAGLGFSLEGGKGSLHGDKPLTINRIFKGTEQGEMVQPGDEILQLAGTAVQGLTRFEAWNVIKALPDGPVTIVIRRTSLQCKQTTASADS

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.