IL-18RAP Protein, Mouse (HEK293, His)
IL-18 is a pleiotropic proinflammatory cytokine that is involved in induction of inflammatory mediators, regulation of the cytotoxic activity of NK cells and T cells, and differentiation and activation of both Th1 and Th2 cells. IL-18 signals through its specific cell surface receptor IL-18R, which comprises two subunits: IL-18Rα and IL-18R beta. IL-18 forms a signalling complex with the IL-18 receptor α (Rα) and β (Rβ) chains at the plasma membrane, which induces multiple inflammatory cytokines. IL-18R complex recruits the IL-1R- activating kinase and TNF- associated factor 6, which phosphorylates nuclear factor kβ- inducing kinase, with subsequent activation of NF- kβ.IL-18R betaknockdown inhibits IL-18 driven tumor cell metastasis in C57/BL6 mice. IL-18RAP Protein, Mouse (HEK293, His) is a recombinant protein with a His label that consists of 337 amino acids (F20-E356) and is produced by HEK293 cells.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
IL-18 is a pleiotropic proinflammatory cytokine that is involved in induction of inflammatory mediators, regulation of the cytotoxic activity of NK cells and T cells, and differentiation and activation of both Th1 and Th2 cells. IL-18 signals through its specific cell surface receptor IL-18R, which comprises two subunits: IL-18Rα and IL-18R beta. IL-18 forms a signalling complex with the IL-18 receptor α (Rα) and β (Rβ) chains at the plasma membrane, which induces multiple inflammatory cytokines[2]. IL-18R complex recruits the IL-1R- activating kinase and TNF- associated factor 6, which phosphorylates nuclear factor kβ- inducing kinase, with subsequent activation of NF- kβ[3].IL-18R betaknockdown inhibits IL-18 driven tumor cell metastasis in C57/BL6 mice[4]. IL-18RAP Protein, Mouse (HEK293, His) is a recombinant protein with a His label that consists of 337 amino acids (F20-E356) and is produced by HEK293 cells.
Background
IL-18R beta (interleukin-18 receptor beta, also known as IL18RAP) is the signal transducing chain of the IL-18R complex and is also a member of the IL-1R family. IL-18R beta is expressed on T-cells, NK cells and dendritic cells, but not commonly expressed in mesenchymal cells[1].
The amino acid sequence of human IL-18R beta protein has low homology for mouse IL-18R beta protein.
IL-18R beta is the receptor of IL-18. IL-18 forms a signaling complex by binding to the IL-18 alpha chain (IL-18Rα). The co-receptor, termed IL-18 receptor beta chain (IL-18Rβ), is recruited to form a high affinity complex[1]. IL-18/IL-18Rα/IL-18Rβ ternary complex formation juxtaposes the intracellular Toll-Interleukin-1 receptor domains of IL-18Rα and IL-18Rβ. Then, the adaptor molecule myeloid differentiation factor 88 (MyD88) is recruited presumably with the aid of TRAM. MyD88 further interacts with IL-1 receptor associating kinase (IRAK) 4 and IRAK1/2 to form the large molecular assembly referred to as Myddosome, which subsequently activates IKK via TRAF6. Finally, the signal activates the NF-κB and mitogen-activated protein kinase pathways7, which upregulate the expression of various inflammatory cytokines[2].
IL-18R beta binds to IL-18 and IL-18 receptor alpha forms a signalling complex induces the expression of various inflammatory cytokines[2]. IL-18R beta knockdown inhibits tumor cell metastasis[4].
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-8*His
-
Accession
Q9Z2B1 (F20-E356)
-
Molecular Construction
-
N-term
-
IL-18RAP (F20-E356)
Accession # Q9Z2B1 -
8*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
IL18RAP; IL-1RAcPL; Interleukin 18 Receptor Accessory Protein; CDw218b; AcPL; IL-1R-7; CD218b; IL-1R7; Interleukin-18 Receptor Accessory Protein; Interleukin-18 Receptor Accessory Protein-Like; CD218 Antigen-Like Family Member B; Cluster Of Differentiatio
-
AA Sequence
FNHSACATKKLLWTYSARGAENFVLFCDLQELQEQKFSHASQLSPTQSPAHKPCSGSQKDLSDVQWYMQPRSGSPLEEISRNSPHMQSEGMLHILAPQTNSIWSYICRPRIRSPQDMACCIKTVLEVKPQRNVSCGNTAQDEQVLLLGSTGSIHCPSLSCQSDVQSPEMTWYKDGRLLPEHKKNPIEMADIYVFNQGLYVCDYTQSDNVSSWTVRAVVKVRTIGKDINVKPEILDPITDTLDVELGKPLTLPCRVQFGFQRLSKPVIKWYVKESTQEWEMSVFEEKRIQSTFKNEVIERTIFLREVTQRDLSRKFVCFAQNSIGNTTRTIRLRKKEE
-
Predicted Molecular Mass
39.7 kDa
-
Molecular Weight
Approximately 55-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
References
[1]. Tsutsumi N, et al. The structural basis for receptor recognition of human interleukin-18. Nat Commun. 2014 Dec 15;5:5340. [Content Brief]
[2]. Watanabe M, et al. Predominant expression of 950delCAG of IL-18R alpha chain cDNA is associated with reduced IFN-gamma production and high serum IgE levels in atopic Japanese children. J Allergy Clin Immunol. 2002 Apr;109(4):669-75. [Content Brief]
[3]. Kim J, et al. Hypoxia-induced IL-18 increases hypoxia-inducible factor-1alpha expression through a Rac1-dependent NF-kappaB pathway. Mol Biol Cell. 2008 Feb;19(2):433-44. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)