Copy Link Print Information

IL-25/IL-17E Protein, Mouse (HEK293, His, solution)

2 Cited Publications
Customer Review

Based on 2 publication(s) in Google Scholar

Interleukin-25 (IL-25), also known as IL-17E, belongs to the IL-17 cytokine family. IL-25 activates NF-κB, MAPKs and JAK/STAT signaling pathways. IL-25 exerts singal transduction through receptors composed of IL17RA and IL17RB. IL-25/IL-17E Protein, Mouse (HEK293, His, solution) is the recombinant mouse-derived IL-25/IL-17E protein, expressed by HEK293 , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Experimental Validation Results for IL-25/IL-17E Protein, Mouse (HEK293, His, solution)
  • IL-25/IL-17E Protein, Mouse (HEK293, His, solution) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Interleukin-25 (IL-25), also known as IL-17E, belongs to the IL-17 cytokine family. IL-25 activates NF-κB, MAPKs and JAK/STAT signaling pathways[1]. IL-25 exerts singal transduction through receptors composed of IL17RA and IL17RB[7]. IL-25/IL-17E Protein, Mouse (HEK293, His, solution) is the recombinant mouse-derived IL-25/IL-17E protein, expressed by HEK293 , with N-His labeled tag.

Background

and is also produced by various immune cells such as CD8+ T cells, mast cells, macrophages, dendritic cells (DCs), eosinophils, basophils, group 2 innate lymphoid cells (ILC2s), epithelial and endothelial cells[1][2][3][4][5][6]. IL-25 exerts singal transduction through receptors composed of IL17RA and IL17RB[7]. IL-25 induces the expression of IL-4, IL-5, IL-13, TGF-β, and G-CSF[8][9]. IL-25 can stimulate cell proliferation, inhibition of apoptosis, production of inflammatory cytokines and chemokines, modulation of cell-cell adhesion, and cell motility in nonimmune cells[10][11][12][13]. IL-25 activates NF-κB, MAPKs and JAK/STATs signaling pathways[1][14]. The sequence homology of IL-25 between human and mouse, mouse and rat is 78.88% and 91.12% respectively.

Verified Bioactivity

1. Measured by its ability to induce CXCL1/GROα secretion in HT29. The ED50 for this effect is 3-14 ng/mL.
2.Immobilized IL17RB Protein, Mouse, Recombinant (hFc Tag) at 2 μg/mL (100 μL/well) can bind IL25/IL17E Protein, Mouse, Recombinant (His Tag),the EC50 is 4-20 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag N-His
  • Accession

    Q8VHH8 (V17-A169)

  • Gene ID
    140806  [NCBI]
  • Molecular Construction
    • N-term
    • His
    • IL-17E (V17-A169)
      Accession # Q8VHH8
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL25; IL-25; Prev. IL17E; Interleukin-25; IL-17E; Interleukin 17E; Interleukin 25; Interleukin-17E

  • AA Sequence

    VSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPLYHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACVCVRPRVMA

  • Predicted Molecular Mass

    20 kDa

  • Molecular Weight

    Approximately 30-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • IL-25/IL-17E Protein, Mouse (HEK293, His, solution) Product Image
    1/16
  • Experimental Validation Results for IL-25/IL-17E Protein, Mouse (HEK293, His, solution)
  • IL-25/IL-17E Protein, Mouse (HEK293, His, solution) Product Image