IL-4 Protein, Bovine
Based on 1 Customer Validation
IL-4 Protein, a key participant in B-cell activation and various cell types, acts as a costimulator of DNA synthesis. It induces class II MHC molecules on B-cells, enhances IgE and IgG1 secretion and expression, and regulates CD23 on lymphocytes and monocytes. IL-4 positively regulates IL31RA in macrophages and stimulates autophagy in dendritic cells by interfering with mTORC1 signaling and inducing RUFY4. IL-4 Protein, Bovine is the recombinant bovine-derived IL-4 protein, expressed by E. coli , with tag free.
- Species: Bovine
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
IL-4 Protein, a key participant in B-cell activation and various cell types, acts as a costimulator of DNA synthesis. It induces class II MHC molecules on B-cells, enhances IgE and IgG1 secretion and expression, and regulates CD23 on lymphocytes and monocytes. IL-4 positively regulates IL31RA in macrophages and stimulates autophagy in dendritic cells by interfering with mTORC1 signaling and inducing RUFY4. IL-4 Protein, Bovine is the recombinant bovine-derived IL-4 protein, expressed by E. coli , with tag free.
Background
IL-4 protein actively participates in multiple B-cell activation processes and influences various cell types as a critical regulator. Functioning as a costimulator, IL-4 stimulates DNA synthesis and induces the expression of class II MHC molecules on resting B-cells. Furthermore, it plays a pivotal role in enhancing both the secretion and cell surface expression of IgE and IgG1, contributing to immune responses. IL-4 also regulates the expression of the low-affinity Fc receptor for IgE (CD23) on lymphocytes and monocytes. Beyond its effects on B-cells, IL-4 positively regulates IL31RA expression in macrophages, further diversifying its immunomodulatory functions. Additionally, IL-4 stimulates autophagy in dendritic cells by interfering with mTORC1 signaling and inducing RUFY4, underscoring its intricate involvement in cellular processes across different immune cell types.
Verified Bioactivity
Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 0.1303 ng/mL ,corresponding to a specific activity is 7.675×106 U/mg
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Bovine
-
Source E. coli
-
Tag Tag Free
-
Accession
P30367 (H25-C135)
-
Molecular Construction
-
N-term
-
IL-4 (H25-C135)
Accession # P30367 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IL4; B_cell Stimulatory Factor 1; Interleukin 4; B-Cell Stimulatory Factor 1; IL-4; B Cell Growth Factor 1; Lymphocyte Stimulatory Factor 1; Binetrakin; Interleukin-4; Pitrakinra; BCGF-1; MGC79402; BCGF1; BSF-1; BSF1
-
AA Sequence
HKCDITLAEIIKTLNILTTRKNSCMELPVADVFAAPKNTTEKETFCRVGIELRRIYRSHTCLNKFLGGLDRNLNSLASKTCSVNEAKTSTSTLKDLLERLKTIMKEKYSKC
-
Predicted Molecular Mass
12.6 kDa
-
Molecular Weight
Approximately 12 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
