1. Recombinant Proteins
  2. Others
  3. IL-4 Protein, Bovine

IL-4 Protein, a key participant in B-cell activation and various cell types, acts as a costimulator of DNA synthesis. It induces class II MHC molecules on B-cells, enhances IgE and IgG1 secretion and expression, and regulates CD23 on lymphocytes and monocytes. IL-4 positively regulates IL31RA in macrophages and stimulates autophagy in dendritic cells by interfering with mTORC1 signaling and inducing RUFY4. IL-4 Protein, Bovine is the recombinant bovine-derived IL-4 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-4 Protein, a key participant in B-cell activation and various cell types, acts as a costimulator of DNA synthesis. It induces class II MHC molecules on B-cells, enhances IgE and IgG1 secretion and expression, and regulates CD23 on lymphocytes and monocytes. IL-4 positively regulates IL31RA in macrophages and stimulates autophagy in dendritic cells by interfering with mTORC1 signaling and inducing RUFY4. IL-4 Protein, Bovine is the recombinant bovine-derived IL-4 protein, expressed by E. coli , with tag free.

Background

IL-4 protein actively participates in multiple B-cell activation processes and influences various cell types as a critical regulator. Functioning as a costimulator, IL-4 stimulates DNA synthesis and induces the expression of class II MHC molecules on resting B-cells. Furthermore, it plays a pivotal role in enhancing both the secretion and cell surface expression of IgE and IgG1, contributing to immune responses. IL-4 also regulates the expression of the low-affinity Fc receptor for IgE (CD23) on lymphocytes and monocytes. Beyond its effects on B-cells, IL-4 positively regulates IL31RA expression in macrophages, further diversifying its immunomodulatory functions. Additionally, IL-4 stimulates autophagy in dendritic cells by interfering with mTORC1 signaling and inducing RUFY4, underscoring its intricate involvement in cellular processes across different immune cell types.

Biological Activity

Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 0.1303 ng/mL ,corresponding to a specific activity is 7.675×106 U/mg

  • Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 0.1303 ng/mL , corresponding to a specific activity is 7.675×106 U/mg
Species

Bovine

Source

E. coli

Tag

Tag Free

Accession

P30367 (H25-C135)

Gene ID
Molecular Construction
N-term
IL-4 (H25-C135)
Accession # P30367
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Interleukin-4; IL-4; B-cell stimulatory factor 1; BSF-1; Lymphocyte stimulatory factor 1; Interleukin 4
AA Sequence

HKCDITLAEIIKTLNILTTRKNSCMELPVADVFAAPKNTTEKETFCRVGIELRRIYRSHTCLNKFLGGLDRNLNSLASKTCSVNEAKTSTSTLKDLLERLKTIMKEKYSKC

Predicted Molecular Mass
12.6 kDa
Molecular Weight

Approximately 12 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-4 Protein, Bovine Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

IL-4 Protein, Bovine

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-4 Protein, Bovine
Cat. No.:
HY-P79117
Quantity:
MCE Japan Authorized Agent: