IRAK4 Protein, Human (Active, 307a.a, sf9)
The IRAK4 protein is a serine/threonine protein kinase that is critical for initiating the innate immune response through the Toll-like receptor (TLR) and IL-1R signaling pathways. After TLR is activated, it rapidly forms the Myddosome with IRAK2. IRAK4, Human (Active, 307a.a, sf9) is the recombinant human-derived IRAK4 protein, expressed by sf9 insect cells, with N-Avi labeled tag.
- Species: Human
- Source: sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The IRAK4 protein is a serine/threonine protein kinase that is critical for initiating the innate immune response through the Toll-like receptor (TLR) and IL-1R signaling pathways. After TLR is activated, it rapidly forms the Myddosome with IRAK2. IRAK4, Human (Active, 307a.a, sf9) is the recombinant human-derived IRAK4 protein, expressed by sf9 insect cells, with N-Avi labeled tag.
Background
The IRAK4 protein functions as a pivotal serine/threonine-protein kinase, playing a crucial role in initiating the innate immune response against foreign pathogens. It is actively involved in Toll-like receptor (TLR) and IL-1R signaling pathways, and upon TLR activation, it is rapidly recruited by MYD88 to form the Myddosome in conjunction with IRAK2. Initially, IRAK1 is phosphorylated, stimulating its kinase activity and inducing intensive autophosphorylation. Additionally, IRAK4 phosphorylates E3 ubiquitin ligases Pellino proteins (PELI1, PELI2, and PELI3), facilitating pellino-mediated polyubiquitination of IRAK1. Consequently, the polyubiquitinated IRAK1 binds with the ubiquitin-binding domain of IKBKG/NEMO, assembling the IRAK1-MAP3K7/TAK1-TRAF6 complex and the NEMO-IKKA-IKKB complex. This, in turn, activates IKKs (CHUK/IKKA and IKBKB/IKKB), leading to nuclear translocation and activation of NF-kappa-B. Alternatively, TIRAP is phosphorylated by IRAK4, promoting its ubiquitination and subsequent degradation. Moreover, IRAK4 phosphorylates NCF1, which regulates NADPH oxidase activation following LPS stimulation, suggesting a similar mechanism during microbial infections.
Technical Parameters
-
Species Human
-
Source sf9 insect cells
-
Tag Tag Free
-
Accession
Q9NWZ3-1 (E154-S460)
-
Gene ID51135
-
Molecular Construction
-
N-term
-
(E154-S460)
Accession # Q9NWZ3-1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
IRAK4; Interleukin-1 Receptor Associated Kinase 4 Mutant Form 2; Interleukin 1 Receptor Associated Kinase 4; Interleukin-1 Receptor-Associated Kinase 4 Isoform 2; Interleukin-1 Receptor-Associated Kinase 4; Non-Specific Serine/Threonine Protein Kinase; NY
-
AA Sequence
ENKSLEVSDTRFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLAAMVDITTEELKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVGTTAYMAPEALRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMNDADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTAS
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipped with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)