ITK Protein, Mouse (sf9, His-GST)

Customer Review

Based on 1 Customer Validation

ITK protein is a tyrosine kinase that plays a crucial role in directing adaptive immune responses by controlling the development, function, and differentiation of conventional T cells and unconventional NKT cells.After T cell receptor (TCR) activation by antigen-presenting cells (APC), ITK is recruited to the cell membrane and phosphorylated by LCK, thereby making it fully activated.ITK Protein, Mouse (sf9, His-GST) is the recombinant mouse-derived ITK protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: Sf9 insect cells
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

ITK protein is a tyrosine kinase that plays a crucial role in directing adaptive immune responses by controlling the development, function, and differentiation of conventional T cells and unconventional NKT cells.After T cell receptor (TCR) activation by antigen-presenting cells (APC), ITK is recruited to the cell membrane and phosphorylated by LCK, thereby making it fully activated.ITK Protein, Mouse (sf9, His-GST) is the recombinant mouse-derived ITK protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

Background

ITK protein, a tyrosine kinase, assumes a critical role in orchestrating the adaptive immune response by governing the development, function, and differentiation of both conventional T-cells and nonconventional NKT-cells. Upon activation of the T-cell receptor (TCR) by antigen-presenting cells (APC), ITK is recruited to the cell membrane in close proximity to the stimulated TCR receptor, where it undergoes phosphorylation by LCK. This phosphorylation initiates ITK autophosphorylation, culminating in its full activation. Once activated, ITK phosphorylates PLCG1, activating this lipase and triggering the subsequent cleavage of its substrates. Consequently, calcium is released from the endoplasmic reticulum into the cytoplasm, facilitating the translocation of the nuclear activator of activated T-cells (NFAT) into the nucleus to execute its transcriptional functions. ITK also phosphorylates two essential adapter proteins, the linker for activation of T-cells/LAT protein and LCP2, leading to the recruitment of various signaling molecules, such as VAV1. This intricate signaling cascade ultimately results in lymphokine production, T-cell proliferation, and differentiation. Moreover, ITK is indispensable for TCR-mediated calcium response in gamma-delta T-cells, potentially influencing the transcriptomic signature in the Vgamma2-positive subset of immature gamma-delta T-cells. Additionally, ITK phosphorylates TBX21 at 'Tyr-525,' mediating its interaction with GATA3. The multifaceted functions of ITK underscore its pivotal role in shaping the adaptive immune response.

Verified Bioactivity

The product demonstrated no detectable kinase activity in an ATP/ADP-based kinase assay.

Technical Parameters

  • Species Mouse
  • Source Sf9 insect cells
  • Tag N-His;N-GST
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His-GST
    • ITK (R357-L625)
      Accession # Q03526
    • C-term
  • Protein Length

    Partial

  • Synonyms

    ITK; T-Cell-Specific Kinase; IL2 Inducible T Cell Kinase; Kinase EMT; EMT; Homolog Of Mouse T-Cell Itk/Tsk; LYK; IL2-Inducible T-Cell Kinase; PSCTK2; IL2 Inducible T-Cell Kinase; Interleukin-2-Inducible T-Cell Kinase; Tyrosine-Protein Kinase LYK; Tyrosine-Protein Kinase ITK/TSK; Tyrosine-Protein Kinase Lyk; IL-2-Inducible T-Cell Kinase; LPFS1

  • AA Sequence

    RYGKWVIQPSELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIQEGAMSEEDFIEEAEVMMKLSHPKLVQLYGVCLEQAPICLVFEFMEHGCLSDYLRSQRGLFAAETLLGMCLDVCEGMAYLEKACVIHRDLAARNCLVGENQVIKVSDFGMTRFVLDDQYTSSTGTKFPVKWASPEVFSFSRYSSKSDVWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASCHVYQIMNHCWKEKPEDRPPFSQLLSQLAEIAEAGL

  • Predicted Molecular Mass

    58.4 kDa

  • Molecular Weight

    Approximately 58 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 100 mM NaCl, pH 7.5, 10% Glycerol, 0.5 mM GSH, 5% trehalose, 5% mannitol and 0.01% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00