ITK Protein, Mouse (sf9, His-GST)
Based on 1 Customer Validation
ITK protein is a tyrosine kinase that plays a crucial role in directing adaptive immune responses by controlling the development, function, and differentiation of conventional T cells and unconventional NKT cells.After T cell receptor (TCR) activation by antigen-presenting cells (APC), ITK is recruited to the cell membrane and phosphorylated by LCK, thereby making it fully activated.ITK Protein, Mouse (sf9, His-GST) is the recombinant mouse-derived ITK protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.
- Species: Mouse
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
ITK protein is a tyrosine kinase that plays a crucial role in directing adaptive immune responses by controlling the development, function, and differentiation of conventional T cells and unconventional NKT cells.After T cell receptor (TCR) activation by antigen-presenting cells (APC), ITK is recruited to the cell membrane and phosphorylated by LCK, thereby making it fully activated.ITK Protein, Mouse (sf9, His-GST) is the recombinant mouse-derived ITK protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.
Background
ITK protein, a tyrosine kinase, assumes a critical role in orchestrating the adaptive immune response by governing the development, function, and differentiation of both conventional T-cells and nonconventional NKT-cells. Upon activation of the T-cell receptor (TCR) by antigen-presenting cells (APC), ITK is recruited to the cell membrane in close proximity to the stimulated TCR receptor, where it undergoes phosphorylation by LCK. This phosphorylation initiates ITK autophosphorylation, culminating in its full activation. Once activated, ITK phosphorylates PLCG1, activating this lipase and triggering the subsequent cleavage of its substrates. Consequently, calcium is released from the endoplasmic reticulum into the cytoplasm, facilitating the translocation of the nuclear activator of activated T-cells (NFAT) into the nucleus to execute its transcriptional functions. ITK also phosphorylates two essential adapter proteins, the linker for activation of T-cells/LAT protein and LCP2, leading to the recruitment of various signaling molecules, such as VAV1. This intricate signaling cascade ultimately results in lymphokine production, T-cell proliferation, and differentiation. Moreover, ITK is indispensable for TCR-mediated calcium response in gamma-delta T-cells, potentially influencing the transcriptomic signature in the Vgamma2-positive subset of immature gamma-delta T-cells. Additionally, ITK phosphorylates TBX21 at 'Tyr-525,' mediating its interaction with GATA3. The multifaceted functions of ITK underscore its pivotal role in shaping the adaptive immune response.
Verified Bioactivity
The product demonstrated no detectable kinase activity in an ATP/ADP-based kinase assay.
Technical Parameters
-
Species Mouse
-
Source Sf9 insect cells
-
Tag N-His;N-GST
-
Accession
Q03526 (R357-L625)
-
Molecular Construction
-
N-term
-
His-GST
-
ITK (R357-L625)
Accession # Q03526 -
C-term
-
-
Protein Length
Partial
-
Synonyms
ITK; T-Cell-Specific Kinase; IL2 Inducible T Cell Kinase; Kinase EMT; EMT; Homolog Of Mouse T-Cell Itk/Tsk; LYK; IL2-Inducible T-Cell Kinase; PSCTK2; IL2 Inducible T-Cell Kinase; Interleukin-2-Inducible T-Cell Kinase; Tyrosine-Protein Kinase LYK; Tyrosine-Protein Kinase ITK/TSK; Tyrosine-Protein Kinase Lyk; IL-2-Inducible T-Cell Kinase; LPFS1
-
AA Sequence
RYGKWVIQPSELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIQEGAMSEEDFIEEAEVMMKLSHPKLVQLYGVCLEQAPICLVFEFMEHGCLSDYLRSQRGLFAAETLLGMCLDVCEGMAYLEKACVIHRDLAARNCLVGENQVIKVSDFGMTRFVLDDQYTSSTGTKFPVKWASPEVFSFSRYSSKSDVWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASCHVYQIMNHCWKEKPEDRPPFSQLLSQLAEIAEAGL
-
Predicted Molecular Mass
58.4 kDa
-
Molecular Weight
Approximately 58 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 100 mM NaCl, pH 7.5, 10% Glycerol, 0.5 mM GSH, 5% trehalose, 5% mannitol and 0.01% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)