JUN Protein, Human (His, Myc)
Based on 1 Customer Validation
JUN Protein, Human (His, Myc) is the recombinant human-derived JUN, expressed by E. coli , with N-10*His, C-Myc labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
JUN Protein, Human (His, Myc) is the recombinant human-derived JUN, expressed by E. coli , with N-10*His, C-Myc labeled tag.
Background
c-Jun is a transcription factor that recognizes and binds to the AP-1 consensus motif 5'-TGA[GC]TCA-3'. It heterodimerizes with FOS family proteins to form the AP-1 transcription complex, enhancing both DNA binding and transcriptional activity (by similarity). Together with FOSB, it participates in activation-induced cell death of T cells by binding to the AP-1 promoter site of FASLG/CD95L and inducing its transcription upon TCR/CD3 signaling pathway activation. When phosphorylated by HIPK3, c-Jun promotes NR5A1 activity, boosting steroidogenic gene expression in response to cAMP pathway stimulation. In colorectal cancer (CRC) cells, it mediates KRAS-activated transcriptional upregulation of USP28 and directly binds to the USP28 promoter. During Epstein-Barr virus (EBV) infection, c-Jun binds to the viral BZLF1 Z promoter to activate BZLF1 expression.
Verified Bioactivity
Immobilized Human JUN Protein at 2 μg/mL (100 μL/well) can bind JUN antibody.The ED50 for this effect is 20-100 ng/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-10*His;C-Myc
-
Accession
P05412 (M1-F331)
-
Gene ID3725
-
Protein Length
Full Length
-
Synonyms
JUN; Jun Oncogene; Jun Proto-Oncogene, AP-1 Transcription Factor Subunit; P39; V-Jun Avian Sarcoma Virus 17 Oncogene Homolog; AP1; Transcription Factor AP-1 Subunit Jun; V-Jun Sarcoma Virus 17 Oncogene Homolog; Transcription Factor Jun; Jun Activation Dom
-
AA Sequence
MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
-
Molecular Weight
Approximately 41-45 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
