JUN Protein, Human (His, Myc)

JUN Protein, Human (His, Myc) is the recombinant human-derived JUN, expressed by E. coli , with N-10*His, C-Myc labeled tag.

c-Jun is a transcription factor that recognizes and binds to the AP-1 consensus motif 5'-TGA[GC]TCA-3'. It heterodimerizes with FOS family proteins to form the AP-1 transcription complex, enhancing both DNA binding and transcriptional activity (by similarity). Together with FOSB, it participates in activation-induced cell death of T cells by binding to the AP-1 promoter site of FASLG/CD95L and inducing its transcription upon TCR/CD3 signaling pathway activation. When phosphorylated by HIPK3, c-Jun promotes NR5A1 activity, boosting steroidogenic gene expression in response to cAMP pathway stimulation. In colorectal cancer (CRC) cells, it mediates KRAS-activated transcriptional upregulation of USP28 and directly binds to the USP28 promoter. During Epstein-Barr virus (EBV) infection, c-Jun binds to the viral BZLF1 Z promoter to activate BZLF1 expression.

Immobilized Human JUN Protein at 2 μg/mL (100 μL/well) can bind JUN antibody.The ED₅₀ for this effect is 20-100 ng/mL.

• 
  Immobilized Human JUN Protein at 2 μg/mL (100 μL/well) can bind JUN antibody.The ED₅₀ for this effect is 24.06 ng/mL.

Human

E. coli

N-10*His;C-Myc

P05412 (M1-F331)

3725

Full Length

MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF

Approximately 41-45 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.