Kras4B Protein, Human (G12S, His)

KRAS protein is a key Ras family member that binds GDP/GTP and has intrinsic GTPase activity. Its critical role in regulating cell proliferation emphasizes its importance in cellular processes. Kras4B Protein, Human (G12S, His) is the recombinant human-derived KRAS, expressed by E. coli, with N-6*His labeled tag.

KRAS, a pivotal member of the Ras protein family, exhibits the ability to bind GDP/GTP and possesses intrinsic GTPase activity. Its crucial involvement in the regulation of cell proliferation underscores its significance in cellular processes. Notably, KRAS plays a prominent role in promoting oncogenic events, particularly in colorectal cancer (CRC), where it induces transcriptional silencing of tumor suppressor genes (TSGs) in a ZNF304-dependent manner. This multifaceted functionality highlights KRAS as a key player in cellular dynamics and emphasizes its relevance in both normal and pathological cellular processes.

1.Biological activity has been tested in vitro. 2.Measured by its ability to catalyze 2m substrate GTP. which can be measured by absorbance at 620 nm that incubate at room temperature for 10 minutes. The specific activity is 716.25 nmo/min/mg.

Human

E. coli

N-6*His

AAH13572.1 (T2-C185, G12S)

3845  [NCBI]

Partial

TEYKLVVVGASGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKC

Approximately 25-30 kDa.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.