1. Recombinant Proteins
  2. Receptor Proteins
  3. LDLR Protein, Human (HEK293, His)

LDLR Protein plays a pivotal role in cholesterol homeostasis, binding to LDL and mediating cellular uptake through endocytosis. Clustering into clathrin-coated pits is essential for internalization. In microbial infection, LDLR acts as a receptor for hepatitis C virus in hepatocytes, emphasizing its dual functionality in cholesterol metabolism and the cellular response to viral infections. LDLR Protein, Human (HEK293, His) is the recombinant human-derived LDLR protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
250 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

2 Publications Citing Use of MCE LDLR Protein, Human (HEK293, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

LDLR Protein plays a pivotal role in cholesterol homeostasis, binding to LDL and mediating cellular uptake through endocytosis. Clustering into clathrin-coated pits is essential for internalization. In microbial infection, LDLR acts as a receptor for hepatitis C virus in hepatocytes, emphasizing its dual functionality in cholesterol metabolism and the cellular response to viral infections. LDLR Protein, Human (HEK293, His) is the recombinant human-derived LDLR protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The LDLR Protein serves as a crucial mediator in cholesterol homeostasis by binding to low-density lipoprotein (LDL), the primary cholesterol-carrying lipoprotein in plasma, and facilitating its cellular uptake through endocytosis. To enable internalization, receptor-ligand complexes must first cluster into clathrin-coated pits. Additionally, in the context of microbial infection, LDLR acts as a receptor for the hepatitis C virus within hepatocytes, although this interaction does not occur through a direct binding with viral proteins. This dual functionality underscores the diverse roles of LDLR in both cholesterol metabolism and the cellular response to viral infections.

In Vitro

LDLR Protein binds to FVIII with Ki of 0.51 μM[1].
LDLR Protein (human, 0-100 nM, 3 hours) binds to low-density lipoprotein in cholesterol (LDL-C), and inhibits the LDL-C uptake in HepG2 cell[2].

Biological Activity

1.Immobilized Human PCSK9 at 2 μg/mL (100 μL/well) can bind Biotinylated Human LDLR. The ED50 for this effect is <0.3 μg/mL.
2.Immobilized Human PCSK9 at 5 μg/mL (100 μL/well) can bind Biotinylated Human LDLR. The ED50 for this effect is <0.13 μg/mL.
3.Immobilized Human PCSK9 at 5 μg/mL (100 μL/well) can bind Human LDLR. The ED50 for this effect is <0.3 μg/mL.

  • Immobilized Human PCSK9 at 2 μg/mL (100 μL/well) can bind Biotinylated Human LDLR. The ED50 for this effect is 278.5 ng/mL, corresponding to a specific activity is 3580.66 Unit/mg.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

P01130-1 (A22-R788)

Gene ID
Molecular Construction
N-term
LDLR (A22-R788)
Accession # P01130-1
6*His
C-term
Protein Length

Partial

Synonyms
rHuLow-density lipoprotein receptor/LDLR, His; Low-Density Lipoprotein Receptor; LDL Receptor; LDLR
AA Sequence

AVGDRCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQETCLSVTCKSGDFSCGGRVNRCIPQFWRCDGQVDCDNGSDEQGCPPKTCSQDEFRCHDGKCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQRCRGLYVFQGDSSPCSAFEFHCLSGECIHSSWRCDGGPDCKDKSDEENCAVATCRPDEFQCSDGNCIHGSRQCDREYDCKDMSDEVGCVNVTLCEGPNKFKCHSGECITLDKVCNMARDCRDWSDEPIKECGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACKAVGSIAYLFFTNRHEVRKMTLDRSEYTSLIPNLRNVVALDTEVASNRIYWSDLSQRMICSTQLDRAHGVSSYDTVISRDIQAPDGLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRENGSKPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLLSPEDMVLFHNLTQPRGVNWCERTTLSNGGCQYLCLPAPQINPHSPKFTCACPDGMLLARDMRSCLTEAEAAVATQETSTVRLKVSSTAVRTQHTTTRPVPDTSRLPGATPGLTTVEIVTMSHQALGDVAGRGNEKKPSSVR

Molecular Weight

Approximately 99-140 kDa due to the glycosylation.

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM HEPES, 150 mM NaCl, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol, 0.01% Tween 80.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

LDLR Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

LDLR Protein, Human (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LDLR Protein, Human (HEK293, His)
Cat. No.:
HY-P70235
Quantity:
MCE Japan Authorized Agent: