1. Recombinant Proteins
  2. Receptor Proteins
  3. LDLR Protein, Human (HEK293, His)

LDLR Protein, Human (HEK293, His)

Cat. No.: HY-P70235
COA Handling Instructions

LDLR Protein plays a pivotal role in cholesterol homeostasis, binding to LDL and mediating cellular uptake through endocytosis. Clustering into clathrin-coated pits is essential for internalization. In microbial infection, LDLR acts as a receptor for hepatitis C virus in hepatocytes, emphasizing its dual functionality in cholesterol metabolism and the cellular response to viral infections. LDLR Protein, Human (HEK293, His) is the recombinant human-derived LDLR protein, expressed by HEK293 , with C-6*His labeled tag. The total length of LDLR Protein, Human (HEK293, His) is 767 a.a., with molecular weight of 99-135 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $63 In-stock
10 μg $107 In-stock
50 μg $300 In-stock
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE LDLR Protein, Human (HEK293, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

LDLR Protein plays a pivotal role in cholesterol homeostasis, binding to LDL and mediating cellular uptake through endocytosis. Clustering into clathrin-coated pits is essential for internalization. In microbial infection, LDLR acts as a receptor for hepatitis C virus in hepatocytes, emphasizing its dual functionality in cholesterol metabolism and the cellular response to viral infections. LDLR Protein, Human (HEK293, His) is the recombinant human-derived LDLR protein, expressed by HEK293 , with C-6*His labeled tag. The total length of LDLR Protein, Human (HEK293, His) is 767 a.a., with molecular weight of 99-135 kDa.

Background

The LDLR Protein serves as a crucial mediator in cholesterol homeostasis by binding to low-density lipoprotein (LDL), the primary cholesterol-carrying lipoprotein in plasma, and facilitating its cellular uptake through endocytosis. To enable internalization, receptor-ligand complexes must first cluster into clathrin-coated pits. Additionally, in the context of microbial infection, LDLR acts as a receptor for the hepatitis C virus within hepatocytes, although this interaction does not occur through a direct binding with viral proteins. This dual functionality underscores the diverse roles of LDLR in both cholesterol metabolism and the cellular response to viral infections.

Biological Activity

Immobilized Human PCSK9 at 2 μg/mL (100 μL/well) can bind Biotinylated Human LDLR. The ED50 for this effect is 278.5 ng/mL, corresponding to a specific activity is 3580.66 Unit/mg.

  • Immobilized Human PCSK9 at 2 μg/mL (100 μL/well) can bind Biotinylated Human LDLR. The ED50 for this effect is 278.5 ng/mL, corresponding to a specific activity is 3580.66 Unit/mg.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

P01130 (A22-R788)

Gene ID
Synonyms
rHuLow-density lipoprotein receptor/LDLR, His; Low-Density Lipoprotein Receptor; LDL Receptor; LDLR
AA Sequence

AVGDRCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQETCLSVTCKSGDFSCGGRVNRCIPQFWRCDGQVDCDNGSDEQGCPPKTCSQDEFRCHDGKCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQRCRGLYVFQGDSSPCSAFEFHCLSGECIHSSWRCDGGPDCKDKSDEENCAVATCRPDEFQCSDGNCIHGSRQCDREYDCKDMSDEVGCVNVTLCEGPNKFKCHSGECITLDKVCNMARDCRDWSDEPIKECGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACKAVGSIAYLFFTNRHEVRKMTLDRSEYTSLIPNLRNVVALDTEVASNRIYWSDLSQRMICSTQLDRAHGVSSYDTVISRDIQAPDGLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRENGSKPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLLSPEDMVLFHNLTQPRGVNWCERTTLSNGGCQYLCLPAPQINPHSPKFTCACPDGMLLARDMRSCLTEAEAAVATQETSTVRLKVSSTAVRTQHTTTRPVPDTSRLPGATPGLTTVEIVTMSHQALGDVAGRGNEKKPSSVR

Molecular Weight

99-135 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM HEPES, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

LDLR Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LDLR Protein, Human (HEK293, His)
Cat. No.:
HY-P70235
Quantity:
MCE Japan Authorized Agent: