MCP-4/CCL13 Protein, Human (His)

MCP-4/CCL13 Protein, Human (His) is the recombinant human-derived MCP-4/CCL13 protein, expressed by E. coli, with N-His tag.

MCP-4/CCL13 is a chemotactic factor that attracts monocytes, lymphocytes, basophils, and eosinophils, but not neutrophils. It signals through CCR2B and CCR3 receptors and plays a role in leukocyte accumulation in both allergic and non-allergic inflammation. Additionally, it may be involved in monocyte recruitment into the arterial wall during atherosclerosis and in tissues chronically exposed to exogenous pathogens.

Human

E. coli

N-His

Q99616 (Q24-T98)

6357

Full Length of C-C motif chemokine 13, short chain

QPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT

Approximately 12-13 kDa, based on SDS-PAGE under reducing conditions.

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from 0.22 μm filtered solution of PBS, pH7.4 with trehalose as protectant.

<1 EU/μg, determined by LAL method.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.