MCP-4/CCL13 Protein, Human (His)
MCP-4/CCL13 Protein, Human (His) is the recombinant human-derived MCP-4/CCL13 protein, expressed by E. coli, with N-His tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
MCP-4/CCL13 Protein, Human (His) is the recombinant human-derived MCP-4/CCL13 protein, expressed by E. coli, with N-His tag.
Background
MCP-4/CCL13 is a chemotactic factor that attracts monocytes, lymphocytes, basophils, and eosinophils, but not neutrophils. It signals through CCR2B and CCR3 receptors and plays a role in leukocyte accumulation in both allergic and non-allergic inflammation. Additionally, it may be involved in monocyte recruitment into the arterial wall during atherosclerosis and in tissues chronically exposed to exogenous pathogens.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
Q99616 (Q24-T98)
-
Gene ID6357
-
Molecular Construction
-
N-term
-
His
-
CCL13 (Q24-T98)
Accession # Q99616 -
C-term
-
-
Protein Length
Full Length of C-C motif chemokine 13, short chain
-
Synonyms
CCL13; Monocyte Chemotactic Protein 4; Prev. SCYA13; C-C Motif Chemokine 13; MCP-4; CK-Beta-10; NCC-1; MGC17134; SCYL1; NCC1; CKb10; Chemokine (C-C Motif) Ligand 13, Isoform CRA_a; Small Inducible Cytokine Subfamily A (Cys-Cys), Member 13; New CC Chemokin
-
AA Sequence
QPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT
-
Predicted Molecular Mass
10.6 kDa
-
Molecular Weight
Approximately 12-13 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
