Myoglobin Protein, Mouse (P.pastoris, His)
Based on 1 Customer Validation
Myoglobin Protein, a crucial member of the globin family, acts as a reserve oxygen supply, facilitating efficient oxygen transport within muscles.Myoglobin Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Myoglobin protein, expressed by P.pastoris , with C-Myc, N-6*His labeled tag.
- Species: Mouse
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Myoglobin Protein, a crucial member of the globin family, acts as a reserve oxygen supply, facilitating efficient oxygen transport within muscles.Myoglobin Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Myoglobin protein, expressed by P.pastoris , with C-Myc, N-6*His labeled tag.
Technical Parameters
-
Species Mouse
-
Source P. pastoris
-
Tag N-6*His
-
Accession
P04247 (G2-G154)
-
Molecular Construction
-
N-term
-
6*His
-
Myoglobin (G2-G154)
Accession # P04247 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
MB; Nitrite Reductase MB; Myoglobin; Pseudoperoxidase MB; PVALB; MYOSB
-
AA Sequence
GLSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFDKFKNLKSEEDMKGSEDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEIIIEVLKKRHSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG
-
Predicted Molecular Mass
18.9 kDa
-
Molecular Weight
Approximately 21 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HC1, 0.5 M NaCl, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
