Lipocalin-2/NGAL Protein, Mouse (HEK293, His, solution)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

Lipocalin-2/NGAL, an iron-trafficking protein, interacts with 2,3-DHBA and modulates cellular iron levels. It acts as a conveyor or extractor of iron, depending on the cellular context. Lipocalin-2/NGAL can increase intracellular iron concentration or reduce it, affecting apoptosis and innate immunity. It can also bind siderophores from M. tuberculosis and exist as a monomer, homodimer, or heterodimer with MMP9. Lipocalin-2/NGAL, Mouse (HEK293, His, solution) is the recombinant mouse-derived Lipocalin-2/NGAL protein, expressed by HEK293, with N-10*His;C-Twin-Strep labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

Lipocalin-2/NGAL, an iron-trafficking protein, interacts with 2,3-DHBA and modulates cellular iron levels. It acts as a conveyor or extractor of iron, depending on the cellular context. Lipocalin-2/NGAL can increase intracellular iron concentration or reduce it, affecting apoptosis and innate immunity. It can also bind siderophores from M. tuberculosis and exist as a monomer, homodimer, or heterodimer with MMP9. Lipocalin-2/NGAL, Mouse (HEK293, His, solution) is the recombinant mouse-derived Lipocalin-2/NGAL protein, expressed by HEK293, with N-10*His;C-Twin-Strep labeled tag.

Background

Lipocalin-2/NGAL, an iron-trafficking protein, participates in various biological processes, including apoptosis, innate immunity, and renal development. Through its interaction with the siderophore 2,3-dihydroxybenzoic acid (2,3-DHBA), reminiscent of bacterial enterobactin, Lipocalin-2/NGAL modulates cellular iron levels, acting as a conveyor or extractor of iron depending on the cellular context. The iron-bound form (holo-24p3) is internalized upon binding to the SLC22A17 (24p3R) receptor, releasing iron and elevating intracellular iron concentration. Conversely, the iron-free form (apo-24p3), upon binding to SLC22A17 (24p3R), associates with an intracellular siderophore, leading to iron chelation and subsequent extracellular iron transfer, thereby diminishing intracellular iron levels. In the realm of apoptosis induced by interleukin-3 (IL3) deprivation, the iron-loaded form averts apoptosis by increasing intracellular iron concentration, while the iron-free form fosters apoptosis by reducing intracellular iron levels, inducing the expression of the proapoptotic protein BCL2L11/BIM. Lipocalin-2/NGAL also plays a crucial role in innate immunity by restraining bacterial proliferation through the sequestration of iron bound to microbial siderophores like enterobactin. Moreover, it exhibits the ability to bind siderophores from M.tuberculosis. Lipocalin-2/NGAL can exist as a monomer, a homodimer linked by disulfide bonds, or a heterodimer with MMP9, further expanding its functional versatility.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • NGAL (Q21-N200)
      Accession # P11672
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    LCN2; P25; Lipocalin 2; Migration-Stimulating Factor Inhibitor; NGAL; Lipocalin 2 (Oncogene 24p3); Neutrophil Gelatinase-Associated Lipocalin; Siderocalin LCN2; Oncogene 24p3; Lipocalin-2; 24p3; MSFI; 25 KDa Alpha-2-Microglobulin-Related Subunit Of MMP-9;

  • AA Sequence

    QDSTQNLIPAPSLLTVPLQPDFRSDQFRGRWYVVGLAGNAVQKKTEGSFTMYSTIYELQENNSYNVTSILVRDQDQGCRYWIRTFVPSSRAGQFTLGNMHRYPQVQSYNVQVATTDYNQFAMVFFRKTSENKQYFKITLYGRTKELSPELKERFTRFAKSLGLKDDNIIFSVPTDQCIDN

  • Predicted Molecular Mass

    21.9 kDa

  • Molecular Weight

    Approximately 20-28 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Histidine-HCl, 8% trehalose, 2% Glycine, 50 mM NaCl, 0.05% Tween 80, pH 6.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00