Lipocalin-2/NGAL Protein, Mouse (HEK293, His, solution)
Based on 1 publication(s) in Google Scholar
Lipocalin-2/NGAL, an iron-trafficking protein, interacts with 2,3-DHBA and modulates cellular iron levels. It acts as a conveyor or extractor of iron, depending on the cellular context. Lipocalin-2/NGAL can increase intracellular iron concentration or reduce it, affecting apoptosis and innate immunity. It can also bind siderophores from M. tuberculosis and exist as a monomer, homodimer, or heterodimer with MMP9. Lipocalin-2/NGAL, Mouse (HEK293, His, solution) is the recombinant mouse-derived Lipocalin-2/NGAL protein, expressed by HEK293, with N-10*His;C-Twin-Strep labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
Lipocalin-2/NGAL, an iron-trafficking protein, interacts with 2,3-DHBA and modulates cellular iron levels. It acts as a conveyor or extractor of iron, depending on the cellular context. Lipocalin-2/NGAL can increase intracellular iron concentration or reduce it, affecting apoptosis and innate immunity. It can also bind siderophores from M. tuberculosis and exist as a monomer, homodimer, or heterodimer with MMP9. Lipocalin-2/NGAL, Mouse (HEK293, His, solution) is the recombinant mouse-derived Lipocalin-2/NGAL protein, expressed by HEK293, with N-10*His;C-Twin-Strep labeled tag.
Background
Lipocalin-2/NGAL, an iron-trafficking protein, participates in various biological processes, including apoptosis, innate immunity, and renal development. Through its interaction with the siderophore 2,3-dihydroxybenzoic acid (2,3-DHBA), reminiscent of bacterial enterobactin, Lipocalin-2/NGAL modulates cellular iron levels, acting as a conveyor or extractor of iron depending on the cellular context. The iron-bound form (holo-24p3) is internalized upon binding to the SLC22A17 (24p3R) receptor, releasing iron and elevating intracellular iron concentration. Conversely, the iron-free form (apo-24p3), upon binding to SLC22A17 (24p3R), associates with an intracellular siderophore, leading to iron chelation and subsequent extracellular iron transfer, thereby diminishing intracellular iron levels. In the realm of apoptosis induced by interleukin-3 (IL3) deprivation, the iron-loaded form averts apoptosis by increasing intracellular iron concentration, while the iron-free form fosters apoptosis by reducing intracellular iron levels, inducing the expression of the proapoptotic protein BCL2L11/BIM. Lipocalin-2/NGAL also plays a crucial role in innate immunity by restraining bacterial proliferation through the sequestration of iron bound to microbial siderophores like enterobactin. Moreover, it exhibits the ability to bind siderophores from M.tuberculosis. Lipocalin-2/NGAL can exist as a monomer, a homodimer linked by disulfide bonds, or a heterodimer with MMP9, further expanding its functional versatility.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Biochem Pharmacol
Blocking the LRH-1/LCN2 axis by ML-180, an LRH-1 inverse agonist, ameliorates osteoarthritis via inhibiting the MAPK pathway. [Abstract]2025 Jul:237:116922. PMID: 40194607
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
P11672 (Q21-N200)
-
Molecular Construction
-
N-term
-
NGAL (Q21-N200)
Accession # P11672 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
LCN2; P25; Lipocalin 2; Migration-Stimulating Factor Inhibitor; NGAL; Lipocalin 2 (Oncogene 24p3); Neutrophil Gelatinase-Associated Lipocalin; Siderocalin LCN2; Oncogene 24p3; Lipocalin-2; 24p3; MSFI; 25 KDa Alpha-2-Microglobulin-Related Subunit Of MMP-9;
-
AA Sequence
QDSTQNLIPAPSLLTVPLQPDFRSDQFRGRWYVVGLAGNAVQKKTEGSFTMYSTIYELQENNSYNVTSILVRDQDQGCRYWIRTFVPSSRAGQFTLGNMHRYPQVQSYNVQVATTDYNQFAMVFFRKTSENKQYFKITLYGRTKELSPELKERFTRFAKSLGLKDDNIIFSVPTDQCIDN
-
Predicted Molecular Mass
21.9 kDa
-
Molecular Weight
Approximately 20-28 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM Histidine-HCl, 8% trehalose, 2% Glycine, 50 mM NaCl, 0.05% Tween 80, pH 6.5.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (262 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)