1. Recombinant Proteins
  2. NGAL Protein, Mouse (HEK293, His)

NGAL Protein, Mouse (HEK293, His)

Cat. No.: HY-P70658
Handling Instructions

NGAL Protein, Mouse (HEK293, His) is an 20-28 kDa NGAL protein with a His-flag, which is expressed in HEK293 cells. NGAL is an antibacterial factor of natural immunity, and an acute-phase protein[1].

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $100 In-stock
Estimated Time of Arrival: December 31
50 μg $300 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
Neutrophil gelatinase-associated lipocalin; NGAL; Lipocalin-2; SV-40-induced 24P3 protein; Siderocalin LCN2; p25; LCN2
Species

Mouse

Source

HEK 293

Accession

P11672 (Q21-N200)

Gene ID

16819

Molecular Weight

20-28 kDa

AA Sequence

QDSTQNLIPAPSLLTVPLQPDFRSDQFRGRWYVVGLAGNAVQKKTEGSFTMYSTIYELQENNSYNVTSILVRDQDQGCRYWIRTFVPSSRAGQFTLGNMHRYPQVQSYNVQVATTDYNQFAMVFFRKTSENKQYFKITLYGRTKELSPELKERFTRFAKSLGLKDDNIIFSVPTDQCIDN

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Biological Activity
Data is not available.
Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM MES, 150 mM NaCl, 5% Trehalose, pH 5.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -80°C. It is stable at -20℃ for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Background

NGAL is a 25 kDa protein belonging to the lipocalin superfamily, which is first known as an antibacterial factor of natural immunity, and an acute-phase protein.
NGAL is initially found in activated neutrophils, and other cells, like kidney tubular cells, may produce NGAL in response to various insults.ipocalin-2 (LCN2/NGAL) has been implicated in a variety of processes including cell differentiation, proliferation, survival, and morphogenesis.NGAL has anti-tumoral and anti-metastatic effects in neoplasias, for example, the colon, ovary and pancreas[1].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NGAL Protein, Mouse (HEK293, His)
Cat. No.:
HY-P70658
Quantity:
MCE Japan Authorized Agent: