NPTX1 Protein, Human (HEK293, His)
Based on 1 Customer Validation
The NPTX1 protein may mediate synaptic processes and may be involved in the uptake of synaptic substances during synaptic remodeling or the clustering of AMPA glutamate receptors at specific excitatory synapses. Its involvement suggests a role in dynamic regulation of synaptic structure and function. NPTX1 Protein, Human (HEK293, His) is the recombinant human-derived NPTX1 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The NPTX1 protein may mediate synaptic processes and may be involved in the uptake of synaptic substances during synaptic remodeling or the clustering of AMPA glutamate receptors at specific excitatory synapses. Its involvement suggests a role in dynamic regulation of synaptic structure and function. NPTX1 Protein, Human (HEK293, His) is the recombinant human-derived NPTX1 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
NPTX1 Protein emerges as a potential mediator in synaptic processes, suggesting involvement in either the uptake of synaptic material during synapse remodeling or the synaptic clustering of AMPA glutamate receptors at specific excitatory synapses. Its implication in these processes points to a role in the dynamic regulation of synaptic structure and function. Elucidating the specific mechanisms through which NPTX1 participates in synapse remodeling and AMPA receptor clustering could provide valuable insights into its role in synaptic plasticity and neurotransmission. Further exploration of NPTX1's functions may deepen our understanding of its specific implications in various neuronal processes and its potential significance in maintaining synaptic integrity and functionality.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q15818 (Q23-N432)
-
Molecular Construction
-
N-term
-
NPTX1 (Q23-N432)
Accession # Q15818 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
NPTX1; NP-I; Neuronal Pentraxin 1; NP1; Neuronal Pentraxin I; Pentraxin Family Member; Neuronal Pentraxin-1; SCA50
-
AA Sequence
QDFGPTRFICTSVPVDADMCAASVAAGGAEELRSSVLQLRETVLQQKETILSQKETIRELTAKLGRCESQSTLDPGAGEARAGGGRKQPGSGKNTMGDLSRTPAAETLSQLGQTLQSLKTRLENLEQYSRLNSSSQTNSLKDLLQSKIDELERQVLSRVNTLEEGKGGPRNDTEERVKIETALTSLHQRISELEKGQKDNRPGDKFQLTFPLRTNYMYAKVKKSLPEMYAFTVCMWLKSSATPGVGTPFSYAVPGQANELVLIEWGNNPMEILINDKVAKLPFVINDGKWHHICVTWTTRDGVWEAYQDGTQGGSGENLAPYHPIKPQGVLVLGQEQDTLGGGFDATQAFVGELAHFNIWDRKLTPGEVYNLATCSTKALSGNVIAWAESHIEIYGGATKWTFEACRQIN
-
Predicted Molecular Mass
45.9 kDa
-
Molecular Weight
Approximately 50-55 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
1.Lyophilized from a 0.22 μm filtered solution of PBS, 1 mM EDTA, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM HEPES, 50 mM NaCl, 6% trehalose, 4% mannitol, 0.02% Tween 20, 1 mM EDTA, pH 8.0.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
