OXT Protein, Human (P.pastoris, His)
Based on 1 Customer Validation
OXT, or oxytocin, induces physiological effects by binding to neurophysin 1 and interacting with the oxytocin receptor (OXTR). This interaction results in smooth muscle contraction in the uterus and mammary gland, crucial for labor and breastfeeding, respectively, by modulating OXTR activity. OXT Protein, Human (P.pastoris, His) is the recombinant human-derived OXT protein, expressed by P. pastoris , with N-6*His labeled tag.
- Species: Human
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
OXT, or oxytocin, induces physiological effects by binding to neurophysin 1 and interacting with the oxytocin receptor (OXTR). This interaction results in smooth muscle contraction in the uterus and mammary gland, crucial for labor and breastfeeding, respectively, by modulating OXTR activity. OXT Protein, Human (P.pastoris, His) is the recombinant human-derived OXT protein, expressed by P. pastoris , with N-6*His labeled tag.
Background
OXT, or oxytocin, exerts its physiological effects through binding to neurophysin 1 and subsequently interacting with the oxytocin receptor (OXTR). This interaction leads to the contraction of smooth muscles in both the uterus and mammary gland. Oxytocin plays a crucial role in mediating uterine contractions during labor and facilitating milk ejection during breastfeeding by modulating the activity of the OXTR.
Technical Parameters
-
Species Human
-
Source P. pastoris
-
Tag N-6*His
-
Accession
P01178 (A32-R125)
-
Molecular Construction
-
N-term
-
6*His
-
OXT (A32-R125)
Accession # P01178 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
OXT; Oxytocin, Prepro- (Neurophysin I); Prev. OT; Neurophysin I; OT-NPI; Oxytocin-Neurophysin I, Preproprotein; Oxytocin-Neurophysin 1; Oxytocin; OXT-NPI; Oxytocin/Neurophysin I Prepropeptide; Oxytocin, Prepropeptide
-
AA Sequence
AAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR
-
Predicted Molecular Mass
11.6 kDa
-
Molecular Weight
Approximately 16 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, 6% Trehalose, pH 7.4 or 20 mM Tris-HC1, 0.5 M NaCl, 6% Trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (234 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
