PAK1 Protein, Human (His-SUMO)

PAK1 is a dynamic protein kinase that plays an important role in multiple intracellular signaling pathways, affecting cytoskeletal dynamics, adhesion, migration, proliferation, apoptosis, mitosis, and vesicle trafficking. Multifunctional PAK1 directly phosphorylates BAD to provide antiapoptotic cell protection. PAK1 Protein, Human (His-SUMO) is the recombinant human-derived PAK1 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

PAK1, a dynamic protein kinase, intricately participates in diverse intracellular signaling pathways downstream of integrins and receptor-type kinases. Its multifaceted roles encompass crucial involvement in cytoskeleton dynamics, cell adhesion, migration, proliferation, apoptosis, mitosis, and vesicle-mediated transport processes. Demonstrating versatility, PAK1 directly phosphorylates BAD, providing cellular protection against apoptosis. Activation is achieved through interaction with CDC42 and RAC1, establishing its position as a GTPase effector that bridges Rho-related GTPases to the JNK MAP kinase pathway. PAK1's reach extends to the phosphorylation and activation of MAP2K1, orchestrating downstream MAP kinase activation. In addition to steering the reorganization of the actin cytoskeleton, actin stress fibers, and focal adhesion complexes, PAK1 also influences tubulin chaperone TBCB, impacting microtubule biogenesis and organization. Noteworthy roles include regulation of insulin secretion in response to elevated glucose levels, participation in the neuromuscular junction formation, and inhibition of activity during apoptosis. PAK1's vast repertoire extends to phosphorylating RAF1, SNAI1, MYL9/MLC2, and contributing to various cellular functions, such as chemokine uptake, synaptic stability, dendritic spine formation, and microtubule nucleation. Its involvement in mediating gastric cancer cell migration, response to DNA damage, and facilitation of stress granules underscore the complexity of PAK1's cellular impact.

The kinase activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

N-SUMO;N-6*His

Q13153-1 (M1-H545)

5058  [NCBI]

Full Length of Isoform-1

MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILPGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATKNNH

Approximately 76.6 kDa

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.