PAK1 Protein, Human (His-SUMO)

Customer Review

Based on 1 Customer Validation

PAK1 is a dynamic protein kinase that plays an important role in multiple intracellular signaling pathways, affecting cytoskeletal dynamics, adhesion, migration, proliferation, apoptosis, mitosis, and vesicle trafficking. Multifunctional PAK1 directly phosphorylates BAD to provide antiapoptotic cell protection. PAK1 Protein, Human (His-SUMO) is the recombinant human-derived PAK1 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

PAK1 is a dynamic protein kinase that plays an important role in multiple intracellular signaling pathways, affecting cytoskeletal dynamics, adhesion, migration, proliferation, apoptosis, mitosis, and vesicle trafficking. Multifunctional PAK1 directly phosphorylates BAD to provide antiapoptotic cell protection. PAK1 Protein, Human (His-SUMO) is the recombinant human-derived PAK1 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Background

PAK1, a dynamic protein kinase, intricately participates in diverse intracellular signaling pathways downstream of integrins and receptor-type kinases. Its multifaceted roles encompass crucial involvement in cytoskeleton dynamics, cell adhesion, migration, proliferation, apoptosis, mitosis, and vesicle-mediated transport processes. Demonstrating versatility, PAK1 directly phosphorylates BAD, providing cellular protection against apoptosis. Activation is achieved through interaction with CDC42 and RAC1, establishing its position as a GTPase effector that bridges Rho-related GTPases to the JNK MAP kinase pathway. PAK1's reach extends to the phosphorylation and activation of MAP2K1, orchestrating downstream MAP kinase activation. In addition to steering the reorganization of the actin cytoskeleton, actin stress fibers, and focal adhesion complexes, PAK1 also influences tubulin chaperone TBCB, impacting microtubule biogenesis and organization. Noteworthy roles include regulation of insulin secretion in response to elevated glucose levels, participation in the neuromuscular junction formation, and inhibition of activity during apoptosis. PAK1's vast repertoire extends to phosphorylating RAF1, SNAI1, MYL9/MLC2, and contributing to various cellular functions, such as chemokine uptake, synaptic stability, dendritic spine formation, and microtubule nucleation. Its involvement in mediating gastric cancer cell migration, response to DNA damage, and facilitation of stress granules underscore the complexity of PAK1's cellular impact.

Verified Bioactivity

The kinase activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-SUMO;N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His-SUMO
    • PAK1 (M1-H545)
      Accession # Q13153-1
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    PAK1; Alpha-PAK; P21 (RAC1) Activated Kinase 1; P65-PAK; P21/Cdc42/Rac1-Activated Kinase 1 (STE20 Homolog, Yeast); Non-Specific Serine/Threonine Protein Kinase; P21/Cdc42/Rac1-Activated Kinase 1 (Yeast Ste20-Related); P21-Activated Kinase 1; P21 Protein (

  • AA Sequence

    MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILPGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATKNNH

  • Predicted Molecular Mass

    76.6 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00