Copy Link Print Information

PDGF-AA Protein, Human (P.pastoris, His)

Customer Review

Based on 1 Customer Validation

PDGF-A protein is a key growth factor that regulates embryonic development, cell proliferation, migration, survival, and chemotaxis, and exerts potent mitogenic effects on mesenchymal cells. It is essential for alveolar septal formation, gastrointestinal tract development, interstitial cell maturation, spermatogenesis, and oligodendrocyte development, and contributes to spinal cord and cerebellar myelination. PDGF-AA Protein, Human (P.pastoris, His) is the recombinant human-derived PDGF-AA protein, expressed by P. pastoris , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: P. pastoris
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • PDGF-AA Protein, Human (P.pastoris, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

PDGF-A protein is a key growth factor that regulates embryonic development, cell proliferation, migration, survival, and chemotaxis, and exerts potent mitogenic effects on mesenchymal cells. It is essential for alveolar septal formation, gastrointestinal tract development, interstitial cell maturation, spermatogenesis, and oligodendrocyte development, and contributes to spinal cord and cerebellar myelination. PDGF-AA Protein, Human (P.pastoris, His) is the recombinant human-derived PDGF-AA protein, expressed by P. pastoris , with N-His labeled tag.

Background

PDGF-A Protein takes center stage as a pivotal growth factor regulating embryonic development, cell proliferation, migration, survival, and chemotaxis. Acknowledged for its potent mitogenic effects on mesenchymal cells, PDGF-A is indispensable for various developmental processes, including the formation of lung alveolar septa, gastrointestinal tract development, Leydig cell maturation, spermatogenesis, and the normal development of oligodendrocytes, contributing to myelination in the spinal cord and cerebellum. Furthermore, PDGF-A assumes a crucial role in wound healing dynamics. The intricacies of its signaling pathway involve modulation through the formation of heterodimers with PDGFB, demonstrating its regulatory versatility. Structurally, PDGF-A adopts a homodimeric configuration with an antiparallel disulfide-linked dimer, and it forms heterodimers with PDGFB, engaging in interactions with PDGFRA homodimers and heterodimers formed by PDGFRA and PDGFRB. Additionally, PDGF-A exhibits an interaction with CSPG4, adding another layer to its multifaceted involvement in cellular processes.

Technical Parameters

  • Species Human
  • Source P. pastoris
  • Tag N-His
  • Accession

    P04085-1 (S87-T211)

  • Gene ID
    5154  [NCBI]
  • Molecular Construction
    • N-term
    • His
    • PDGF-AA (S87-T211)
      Accession # P04085-1
    • C-term
  • Protein Length

    Full Length of Isoform-1 Mature Protein

  • Synonyms

    PDGFA; Platelet-Derived Growth Factor Alpha Chain; Platelet Derived Growth Factor Subunit A; Platelet-Derived Growth Factor A Chain; Platelet-Derived Growth Factor Alpha Polypeptide; PDGF Subunit A; PDGF1; PDGF A-Chain; Platelet-Derived Growth Factor Subu

  • AA Sequence

    SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT

  • Predicted Molecular Mass

    16.3 kDa

  • Molecular Weight

    Approximately 18-25 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 30% CAN, 0.1% TFA, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • PDGF-AA Protein, Human (P.pastoris, His) Product Image
    1/16
  • PDGF-AA Protein, Human (P.pastoris, His) Product Image