1. Recombinant Proteins
  2. PDGF-BB Protein, Human (P.pastoris)

PDGF-BB Protein, Human (P.pastoris)

Cat. No.: HY-P7055A
Handling Instructions

PDGF-BB Protein, Human (P.pastoris) is the most active PDGF isoform, binds to PDGF receptor, promotes diverse cell types proliferation and osteogenesis, and further stimulates bone formation in fracture or defect.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $190 In-stock
Estimated Time of Arrival: December 31
50 μg $590 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rHuPDGF-BB; PDGF-2; GDGF; ODGF; SIS; SSV
Species

Human

Source

P. pastoris

Accession

P01127 (S82-T190)

Gene ID

5155

Molecular Weight

Approximately 24.3 kDa

AA Sequence

SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT

Biological Activity
The ED50 is <3 ng/mL as measured by Balb/c 3T3 cells, corresponding to a specific activity of >3.3 × 105 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 10 mM acetic acid.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Recombinant Human Platelet-derived Growth Factor-BB (P.pastoris-expressed) is the most active PDGF isoform, binds to PDGF receptor, promotes diverse cell types proliferation and osteogenesis, and further stimulates bone formation in fracture or defect. Platelet-derived growth factor-BB (PDGF-BB) is primarily secreted from platelet α-granules and is the most active PDGF isoform in bone and other connective tissue as it can bind to all known PDGF receptors. PDGF-BB plays an important role in bone regeneration by inducing mitogenesis, chemotaxis, extracellular matrix formation, and vascularization[1]. Recombinant Human Platelet-derived Growth Factor-BB (rhPDGF-BB) accelerates tendon healing by improving matrix remodeling, increased collagen synthesis, and increased cell proliferation. Recombinant Human Platelet-derived Growth Factor-BB is also efficacious in a non-ruptured, degenerated, tendinopathy model. Furthermore, Recombinant Human Platelet-derived Growth Factor-BB addresses chronic tendinopathies by inducing proliferation and migration of progenitor cells and tenocytes, which stimulate structural repair of the degenerated tendon[2].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PDGF-BB Protein, Human (P.pastoris)
Cat. No.:
HY-P7055A
Quantity:
MCE Japan Authorized Agent: