1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. PDGFs & PDGFRs
  4. PDGF
  5. PDGF-C
  6. PDGF-CC Protein, Mouse (P.pastoris, His)

The PDGF-CC protein is a key growth factor that plays crucial roles in a variety of cellular processes, including embryonic development, cell proliferation, migration, survival, and chemotaxis. It has potent mitogenic and chemoattractant properties and is essential during embryonic skeletal formation, craniofacial development, palate development, skin morphogenesis and wound healing stages. PDGF-CC Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived PDGF-CC protein, expressed by P. pastoris , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PDGF-CC protein is a key growth factor that plays crucial roles in a variety of cellular processes, including embryonic development, cell proliferation, migration, survival, and chemotaxis. It has potent mitogenic and chemoattractant properties and is essential during embryonic skeletal formation, craniofacial development, palate development, skin morphogenesis and wound healing stages. PDGF-CC Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived PDGF-CC protein, expressed by P. pastoris , with N-His labeled tag.

Background

PDGF-CC Protein, a pivotal growth factor, assumes a critical role in orchestrating diverse cellular processes, spanning embryonic development, cell proliferation, migration, survival, and chemotaxis. Demonstrating potent mitogenic and chemoattractant properties for mesenchymal cells, PDGF-CC emerges as a key player in the intricate landscape of embryonic skeleton formation, particularly in craniofacial and palate development, as well as in the morphogenesis of the skin. Its involvement in wound healing encompasses pivotal contributions to inflammation, proliferation, and remodeling stages. Moreover, PDGF-CC is a central figure in angiogenesis and blood vessel development, wielding influence in fibrotic processes by orchestrating the transformation of interstitial fibroblasts into myofibroblasts and facilitating collagen deposition. Beyond its canonical roles, the CUB domain hints at additional mitogenic activities, particularly in coronary artery smooth muscle cells. In the nucleus, PDGF-CC unveils additional functions, underscoring its multifaceted regulatory capacities. Homodimeric and disulfide-linked, PDGF-CC engages in intricate interactions with PDGFRA homodimers and heterodimers formed by PDGFRA and PDGFRB, while also interacting with PLAT via its CUB domain.

Species

Mouse

Source

P. pastoris

Tag

N-His

Accession

Q8CI19 (V235-G345)

Gene ID
Molecular Construction
N-term
His
PDGF-CC (V235-G345)
Accession # Q8CI19
C-term
Protein Length

Partial

Synonyms
PDGF-C; Platelet derived growth factor C; VEGF-E; SCDGF
AA Sequence

VVNLNLLKEEVKLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPRKVTKKYHEVLQLRPKTGVKGLHKSLTDVALEHHEECDCVCRGNAGG

Predicted Molecular Mass
14.4 kDa
Molecular Weight

Approximately 21-25 kDa, based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

PDGF-CC Protein, Mouse (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PDGF-CC Protein, Mouse (P.pastoris, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PDGF-CC Protein, Mouse (P.pastoris, His)
Cat. No.:
HY-P73719
Quantity:
MCE Japan Authorized Agent: