PDGF-CC Protein, Mouse (P.pastoris, His)
Based on 1 Customer Validation
The PDGF-CC protein is a key growth factor that plays crucial roles in a variety of cellular processes, including embryonic development, cell proliferation, migration, survival, and chemotaxis. It has potent mitogenic and chemoattractant properties and is essential during embryonic skeletal formation, craniofacial development, palate development, skin morphogenesis and wound healing stages. PDGF-CC Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived PDGF-CC protein, expressed by P. pastoris , with N-His labeled tag.
- Species: Mouse
- Source: P. pastoris
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The PDGF-CC protein is a key growth factor that plays crucial roles in a variety of cellular processes, including embryonic development, cell proliferation, migration, survival, and chemotaxis. It has potent mitogenic and chemoattractant properties and is essential during embryonic skeletal formation, craniofacial development, palate development, skin morphogenesis and wound healing stages. PDGF-CC Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived PDGF-CC protein, expressed by P. pastoris , with N-His labeled tag.
Background
PDGF-CC Protein, a pivotal growth factor, assumes a critical role in orchestrating diverse cellular processes, spanning embryonic development, cell proliferation, migration, survival, and chemotaxis. Demonstrating potent mitogenic and chemoattractant properties for mesenchymal cells, PDGF-CC emerges as a key player in the intricate landscape of embryonic skeleton formation, particularly in craniofacial and palate development, as well as in the morphogenesis of the skin. Its involvement in wound healing encompasses pivotal contributions to inflammation, proliferation, and remodeling stages. Moreover, PDGF-CC is a central figure in angiogenesis and blood vessel development, wielding influence in fibrotic processes by orchestrating the transformation of interstitial fibroblasts into myofibroblasts and facilitating collagen deposition. Beyond its canonical roles, the CUB domain hints at additional mitogenic activities, particularly in coronary artery smooth muscle cells. In the nucleus, PDGF-CC unveils additional functions, underscoring its multifaceted regulatory capacities. Homodimeric and disulfide-linked, PDGF-CC engages in intricate interactions with PDGFRA homodimers and heterodimers formed by PDGFRA and PDGFRB, while also interacting with PLAT via its CUB domain.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Mouse
-
Source P. pastoris
-
Tag N-His
-
Accession
Q8CI19 (V235-G345)
-
Molecular Construction
-
N-term
-
His
-
PDGF-CC (V235-G345)
Accession # Q8CI19 -
C-term
-
-
Protein Length
Partial
-
Synonyms
PDGFC; Platelet-Derived Growth Factor C; Platelet Derived Growth Factor C; PDGF-C; Fallotein; VEGF-E; SCDGF; Secretory Growth Factor-Like Protein; Spinal Cord-Derived Growth Factor
-
AA Sequence
VVNLNLLKEEVKLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPRKVTKKYHEVLQLRPKTGVKGLHKSLTDVALEHHEECDCVCRGNAGG
-
Predicted Molecular Mass
14.4 kDa
-
Molecular Weight
Approximately 21-25 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)