Pellino-1 Protein, Human

Pellino-1 protein is an E3 ubiquitin ligase that links ubiquitin to substrate proteins. Pellino-1 Protein, Human is the recombinant human-derived Pellino-1 protein, expressed by E. coli, with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Pellino-1 protein is an E3 ubiquitin ligase that links ubiquitin to substrate proteins. Pellino-1 Protein, Human is the recombinant human-derived Pellino-1 protein, expressed by E. coli, with tag free.

Background

Pellino-1, functioning as an E3 ubiquitin ligase, orchestrates the covalent attachment of ubiquitin moieties onto substrate proteins, particularly playing a crucial role in the Toll-like receptor (TLR) and interleukin-1 (IL-1) signaling pathways through its interaction with the complex containing IRAK kinases and TRAF6. Notably, Pellino-1 mediates 'Lys-63'-linked polyubiquitination of IRAK1, a pivotal step facilitating subsequent NF-kappa-B activation. Additionally, it exhibits a regulatory role in cell fate decisions, as it catalyzes 'Lys-48'-linked polyubiquitination of RIPK3, leading to its proteasome-dependent degradation, with a preference for the 'Thr-182' phosphorylated form of RIPK3. Intriguingly, Pellino-1 negatively modulates necroptosis by downregulating RIPK3 expression through its ubiquitin ligase activity. Furthermore, Pellino-1 extends its regulatory influence by mediating 'Lys-63'-linked ubiquitination of RIPK1, thereby contributing to the intricate modulation of cellular responses within these critical signaling pathways.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Pellino-1 (F2-D418)
      Accession # Q96FA3
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    PELI1; E3 Ubiquitin-Protein Ligase Pellino Homolog; Pellino E3 Ubiquitin Protein Ligase 1; Pellino (Drosophila) Homolog 1; RING-Type E3 Ubiquitin Transferase Pellino Homolog 1; Pellino Homolog 1 (Drosophila); Pellino-Related Intracellular-Signaling Molecu

  • AA Sequence

    FSPDQENHPSKAPVKYGELIVLGYNGSLPNGDRGRRKSRFALFKRPKANGVKPSTVHIACTPQAAKAISNKDQHSISYTLSRAQTVVVEYTHDSNTDMFQIGRSTESPIDFVVTDTVPGSQSNSDTQSVQSTISRFACRIICERNPPFTARIYAAGFDSSKNIFLGEKAAKWKTSDGQMDGLTTNGVLVMHPRNGFTEDSKPGIWREISVCGNVFSLRETRSAQQRGKMVEIETNQLQDGSLIDLCGATLLWRTAEGLSHTPTVKHLEALRQEINAARPQCPVGFNTLAFPSMKRKDVVDEKQPWVYLNCGHVHGYHNWGNKEERDGKDRECPMCRSVGPYVPLWLGCEAGFYVDAGPPTHAFSPCGHVCSEKTTAYWSQIPLPHGTHTFHAACPFCAHQLAGEQGYIRLIFQGPLD

  • Predicted Molecular Mass

    46.3 kDa

  • Purity

    ≥ 80%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00