Pellino-1 Protein, Human
Pellino-1 protein is an E3 ubiquitin ligase that links ubiquitin to substrate proteins. Pellino-1 Protein, Human is the recombinant human-derived Pellino-1 protein, expressed by E. coli, with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Pellino-1 protein is an E3 ubiquitin ligase that links ubiquitin to substrate proteins. Pellino-1 Protein, Human is the recombinant human-derived Pellino-1 protein, expressed by E. coli, with tag free.
Pellino-1, functioning as an E3 ubiquitin ligase, orchestrates the covalent attachment of ubiquitin moieties onto substrate proteins, particularly playing a crucial role in the Toll-like receptor (TLR) and interleukin-1 (IL-1) signaling pathways through its interaction with the complex containing IRAK kinases and TRAF6. Notably, Pellino-1 mediates 'Lys-63'-linked polyubiquitination of IRAK1, a pivotal step facilitating subsequent NF-kappa-B activation. Additionally, it exhibits a regulatory role in cell fate decisions, as it catalyzes 'Lys-48'-linked polyubiquitination of RIPK3, leading to its proteasome-dependent degradation, with a preference for the 'Thr-182' phosphorylated form of RIPK3. Intriguingly, Pellino-1 negatively modulates necroptosis by downregulating RIPK3 expression through its ubiquitin ligase activity. Furthermore, Pellino-1 extends its regulatory influence by mediating 'Lys-63'-linked ubiquitination of RIPK1, thereby contributing to the intricate modulation of cellular responses within these critical signaling pathways.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q96FA3 (F2-D418)
-
Gene ID57162
-
Molecular Construction
-
N-term
-
Pellino-1 (F2-D418)
Accession # Q96FA3 -
C-term
-
-
Protein Length
Partial
-
Synonyms
PELI1; E3 Ubiquitin-Protein Ligase Pellino Homolog; Pellino E3 Ubiquitin Protein Ligase 1; Pellino (Drosophila) Homolog 1; RING-Type E3 Ubiquitin Transferase Pellino Homolog 1; Pellino Homolog 1 (Drosophila); Pellino-Related Intracellular-Signaling Molecu
-
AA Sequence
FSPDQENHPSKAPVKYGELIVLGYNGSLPNGDRGRRKSRFALFKRPKANGVKPSTVHIACTPQAAKAISNKDQHSISYTLSRAQTVVVEYTHDSNTDMFQIGRSTESPIDFVVTDTVPGSQSNSDTQSVQSTISRFACRIICERNPPFTARIYAAGFDSSKNIFLGEKAAKWKTSDGQMDGLTTNGVLVMHPRNGFTEDSKPGIWREISVCGNVFSLRETRSAQQRGKMVEIETNQLQDGSLIDLCGATLLWRTAEGLSHTPTVKHLEALRQEINAARPQCPVGFNTLAFPSMKRKDVVDEKQPWVYLNCGHVHGYHNWGNKEERDGKDRECPMCRSVGPYVPLWLGCEAGFYVDAGPPTHAFSPCGHVCSEKTTAYWSQIPLPHGTHTFHAACPFCAHQLAGEQGYIRLIFQGPLD
-
Predicted Molecular Mass
46.3 kDa
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)