PF-4/CXCL4 Protein, Human (His-Avi)
Wnt-10b protein is a signaling molecule that plays a key role in embryonic development and tissue homeostasis. It is involved in regulating cell proliferation, differentiation and migration. PF-4/CXCL4 Protein, Human (His-Avi) is the recombinant human-derived PF-4/CXCL4 protein, expressed by E. coli , with C-Avi, N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Wnt-10b protein is a signaling molecule that plays a key role in embryonic development and tissue homeostasis. It is involved in regulating cell proliferation, differentiation and migration. PF-4/CXCL4 Protein, Human (His-Avi) is the recombinant human-derived PF-4/CXCL4 protein, expressed by E. coli , with C-Avi, N-His labeled tag.
Background
The PF-4/CXCL4 Protein, a member of the CXC chemokine family, is encoded by this gene. Released from the alpha granules of activated platelets in the form of a homotetramer, this chemokine exhibits high affinity for heparin and plays a crucial role in platelet aggregation. Beyond its involvement in platelet function, PF-4/CXCL4 is chemotactic for various cell types and serves as an inhibitor of hematopoiesis, angiogenesis, and T-cell function. Additionally, it demonstrates antimicrobial activity against Plasmodium falciparum. The gene displays biased expression, with elevated levels in the bone marrow (RPKM 14.3), spleen (RPKM 2.7), and one other tissue, underscoring its potential significance in various physiological contexts across multiple organs.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-Avi;N-8*His
-
Accession
NP_002610.1 (E32-S101)
-
Molecular Construction
-
N-term
-
8*His-Avi
-
CXCL4 (E32-S101)
Accession # NP_002610.1 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
PF4; C-X-C Motif Chemokine 4; Platelet Factor 4; Oncostatin-A; SCYB4; Iroplact; CXCL4; PF-4; Chemokine (C-X-C Motif) Ligand 4
-
AA Sequence
EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
-
Predicted Molecular Mass
10.7 kDa
-
Molecular Weight
Approximately 11 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in 4mM HCl, pH 3.0.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
