PKMYT1 Protein, Human
PKMYT1 Protein, Human is the recombinant human-derived PKMYT1, expressed by E. coli , with tag Free labeled tag. ,
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
PKMYT1 Protein, Human is the recombinant human-derived PKMYT1, expressed by E. coli , with tag Free labeled tag. ,
MYT1 acts as a negative regulator of mitotic entry (G2 to M transition) by phosphorylating CDK1 kinase specifically when complexed with cyclins. It predominantly mediates phosphorylation of CDK1 at 'Thr-14'. Additionally, MYT1 is involved in Golgi fragmentation. It may also contribute to CDK1 phosphorylation at 'Tyr-15' to a lesser extent, though its tyrosine kinase activity remains unclear and potentially indirect (by similar).
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q99640-1 (H75-P362)
-
Gene ID9088
-
Protein Length
Partial
-
Synonyms
PKMYT1; Myt1 Kinase; Protein Kinase, Membrane Associated Tyrosine/Threonine 1; PPP1R126; Membrane-Associated Tyrosine- And Threonine-Specific Cdc2-Inhibitory Kinase; Protein Phosphatase 1, Regulatory Subunit 126; MYT1; Non-Specific Serine/Threonine Protei
-
AA Sequence
HQLQPRRVSFRGEASETLQSPGYDPSRPESFFQQSFQRLSRLGHGSYGEVFKVRSKEDGRLYAVKRSMSPFRGPKDRARKLAEVGSHEKVGQHPCCVRLEQAWEEGGILYLQTELCGPSLQQHCEAWGASLPEAQVWGYLRDTLLALAHLHSQGLVHLDVKPANIFLGPRGRCKLGDFGLLVELGTAGAGEVQEGDPRYMAPELLQGSYGTAADVFSLGLTILEVACNMELPHGGEGWQQLRQGYLPPEFTAGLSSELRSVLVMMLEPDPKLRATAEALLALPVLRQP
-
Predicted Molecular Mass
31.9 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
