Copy Link Print Information

Plexin B1 Protein, Human (HEK293, mFc)

Customer Review

Based on 1 Customer Validation

Plexin B1 protein is a receptor for SEMA4D and has a critical influence on GABAergic and inhibitory synapse development. It activates RHOA, leading to changes in the actin cytoskeleton, affecting axonal guidance, invasive growth and cell migration. Plexin B1 Protein, Human (HEK293, mFc) is the recombinant human-derived Plexin B1 protein, expressed by HEK293 , with N-mFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Plexin B1 Protein, Human (HEK293, mFc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Plexin B1 protein is a receptor for SEMA4D and has a critical influence on GABAergic and inhibitory synapse development. It activates RHOA, leading to changes in the actin cytoskeleton, affecting axonal guidance, invasive growth and cell migration. Plexin B1 Protein, Human (HEK293, mFc) is the recombinant human-derived Plexin B1 protein, expressed by HEK293 , with N-mFc labeled tag.

Background

The Plexin B1 Protein acts as a receptor for SEMA4D, playing a critical role in GABAergic synapse development and mediating SEMA4A- and SEMA4D-dependent inhibitory synapse development. Additionally, it is involved in RHOA activation and subsequent changes in the actin cytoskeleton, contributing to axon guidance, invasive growth, and cell migration. It exists as a monomer and forms heterodimers with PLXNB2 after proteolytic processing. Plexin B1 binds to activated RAC1 and interacts with various proteins, including PLXNA1, ARHGEF11, ARHGEF12, ERBB2, MET, MST1R, RRAS, RHOD, RND1, NRP1, and NRP2. The interaction with SEMA4D promotes the binding of cytoplasmic ligands, emphasizing its intricate involvement in cellular signaling pathways and synaptic development.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized human SEMA4D at 5 μg/mL can bind human PLXNB1, the EC50 is 246.8-883.4 ng/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag N-mFc
  • Accession

    O43157 (L20-Q535)

  • Gene ID
    5364  [NCBI]
  • Molecular Construction
    • N-term
    • mFc
    • Plexin B1 (L20-Q535)
      Accession # O43157
    • C-term
  • Protein Length

    Partial

  • Synonyms

    PLXNB1; Semaphorin Receptor SEP; Prev. PLXN5; PLEXIN-B1; SEP; Plexin-B1; KIAA0407; Plexin 5; Plexin B1; PLXNB1 Protein

  • AA Sequence

    LQPLPPTAFTPNGTYLQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQYVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSRGVGGGIPPITTRALWPPDPQAAFSYEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQSRAFRAYVSRVCLRDQHYYSYVELPLACEGGRYGLIQAAAVATSREVAHGEVLFAAFSSAAPPTVGRPPSAAAGASGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIEYDVNSDCAQLPVDTLDAYPCGSDHTPSPMASRVPLEATPILEWPGIQLTAVAVTMEDGHTIAFLGDSQGQLHRVYLGPGSDGHPYSTQSIQQGSAVSRDLTFDGTFEHLYVMTQSTLLKVPVASCAQHLDCASCLAHRDPYCGWCVLLGRCSRRSECSRGQGPEQWLWSFQPELGCLQ

  • Predicted Molecular Mass

    83.2 kDa

  • Molecular Weight

    Approximately 86 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Plexin B1 Protein, Human (HEK293, mFc) Product Image
    1/16
  • Plexin B1 Protein, Human (HEK293, mFc) Product Image