1. Recombinant Proteins
  2. Others
  3. Plexin B1 Protein, Human (HEK293, mFc)

Plexin B1 protein is a receptor for SEMA4D and has a critical influence on GABAergic and inhibitory synapse development. It activates RHOA, leading to changes in the actin cytoskeleton, affecting axonal guidance, invasive growth and cell migration. Plexin B1 Protein, Human (HEK293, mFc) is the recombinant human-derived Plexin B1 protein, expressed by HEK293 , with N-mFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Plexin B1 protein is a receptor for SEMA4D and has a critical influence on GABAergic and inhibitory synapse development. It activates RHOA, leading to changes in the actin cytoskeleton, affecting axonal guidance, invasive growth and cell migration. Plexin B1 Protein, Human (HEK293, mFc) is the recombinant human-derived Plexin B1 protein, expressed by HEK293 , with N-mFc labeled tag.

Background

The Plexin B1 Protein acts as a receptor for SEMA4D, playing a critical role in GABAergic synapse development and mediating SEMA4A- and SEMA4D-dependent inhibitory synapse development. Additionally, it is involved in RHOA activation and subsequent changes in the actin cytoskeleton, contributing to axon guidance, invasive growth, and cell migration. It exists as a monomer and forms heterodimers with PLXNB2 after proteolytic processing. Plexin B1 binds to activated RAC1 and interacts with various proteins, including PLXNA1, ARHGEF11, ARHGEF12, ERBB2, MET, MST1R, RRAS, RHOD, RND1, NRP1, and NRP2. The interaction with SEMA4D promotes the binding of cytoplasmic ligands, emphasizing its intricate involvement in cellular signaling pathways and synaptic development.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized human SEMA4D at 5 μg/mL can bind human PLXNB1, the EC50 is 246.8-883.4 ng/mL.

Species

Human

Source

HEK293

Tag

N-mFc

Accession

O43157 (L20-Q535)

Gene ID
Molecular Construction
N-term
mFc
Plexin B1 (L20-Q535)
Accession # O43157
C-term
Protein Length

Partial

Synonyms
Plexin-B1; PLXNB1; Semaphorin receptor SEP; KIAA0407; PLXN5; SEP
AA Sequence

LQPLPPTAFTPNGTYLQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQYVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSRGVGGGIPPITTRALWPPDPQAAFSYEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQSRAFRAYVSRVCLRDQHYYSYVELPLACEGGRYGLIQAAAVATSREVAHGEVLFAAFSSAAPPTVGRPPSAAAGASGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIEYDVNSDCAQLPVDTLDAYPCGSDHTPSPMASRVPLEATPILEWPGIQLTAVAVTMEDGHTIAFLGDSQGQLHRVYLGPGSDGHPYSTQSIQQGSAVSRDLTFDGTFEHLYVMTQSTLLKVPVASCAQHLDCASCLAHRDPYCGWCVLLGRCSRRSECSRGQGPEQWLWSFQPELGCLQ

Predicted Molecular Mass
83.2 kDa
Molecular Weight

Approximately 86 kDa, based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Plexin B1 Protein, Human (HEK293, mFc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Plexin B1 Protein, Human (HEK293, mFc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Plexin B1 Protein, Human (HEK293, mFc)
Cat. No.:
HY-P700428
Quantity:
MCE Japan Authorized Agent: