PRDX1/Peroxiredoxin-1 Protein, Human (His)
Based on 2 publication(s) in Google Scholar
Peroxiredoxin-1 (PRDX1) is a thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides and plays a crucial role in cellular protection against oxidative stress. It detoxifies peroxide and senses hydrogen peroxide-mediated signaling events. PRDX1/Peroxiredoxin-1 Protein, Human (His) is the recombinant human-derived PRDX1 protein, expressed by E. coli , with C-6*His, N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Peroxiredoxin-1 (PRDX1) is a thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides and plays a crucial role in cellular protection against oxidative stress. It detoxifies peroxide and senses hydrogen peroxide-mediated signaling events. PRDX1/Peroxiredoxin-1 Protein, Human (His) is the recombinant human-derived PRDX1 protein, expressed by E. coli , with C-6*His, N-6*His labeled tag.
Peroxiredoxin-1 (PRDX1), a thiol-specific peroxidase, serves as a catalytic agent in the reduction of hydrogen peroxide and organic hydroperoxides, converting them into water and alcohols, respectively. Its crucial role in cellular protection against oxidative stress involves detoxifying peroxides and acting as a sensor for hydrogen peroxide-mediated signaling events. PRDX1 may also contribute to the signaling cascades initiated by growth factors and tumor necrosis factor-alpha, potentially influencing intracellular H(2)O(2) concentrations. Notably, PRDX1 exhibits the ability to reduce an intramolecular disulfide bond in GDPD5, modulating GDPD5's capacity to drive postmitotic motor neuron differentiation. These multifaceted functions underscore PRDX1's intricate involvement in redox signaling and cellular differentiation processes.
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Publications (2)
-
Journal Impact Factor
-
Most Recent
-
Cell Death Dis
Targeting PRDX1 impairs acute myeloid leukemic blasts and stem cells by disrupting redox homeostasis. [Abstract]2025 Aug 18;16(1):627. PMID: 40825764 -
Small
Laminin-Augmented Decellularized Extracellular Matrix Ameliorating Neural Differentiation and Neuroinflammation in Human Mini-Brains. [Abstract]2024 Jun;20(23):e2308815. PMID: 38161254
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His;N-6*His
-
Accession
Q06830 (M1-K199)
-
Molecular Construction
-
N-term
-
PRDX1 (M1-K199)
Accession # Q06830 -
6*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
PRDX1; TDPX2; Prev. PAGA; PAG; Thioredoxin-Dependent Peroxide Reductase 2; Epididymis Secretory Sperm Binding Protein; Thioredoxin-Dependent Peroxiredoxin 1; Thioredoxin-Dependent Peroxiredoxin; Thioredoxin Peroxidase 2; Natural Killer-Enhancing Factor A;
-
AA Sequence
MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK
-
Predicted Molecular Mass
25.3 kDa
-
Molecular Weight
Approximately 26 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, 10% glycerol, 0.1 mM DTT, pH 6.0.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
