PRKCA Protein, Human (Active, sf9, GST)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

PRKCA Protein, Human (sf9, GST) is the recombinant human-derived PRKCA, expressed by Sf9 insect cells , with N-GST labeled tag. ,

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

PRKCA Protein, Human (sf9, GST) is the recombinant human-derived PRKCA, expressed by Sf9 insect cells , with N-GST labeled tag. ,

Background

PKC alpha is a calcium-activated, phospholipid- and diacylglycerol (DAG)-dependent serine/threonine-protein kinase that regulates cell proliferation, apoptosis, differentiation, migration, adhesion, tumorigenesis, cardiac hypertrophy, angiogenesis, platelet function, and inflammation by directly phosphorylating targets like RAF1, BCL2, CSPG4, and TNNT2/CTNT or activating signaling cascades involving MAPK1/3 (ERK1/2) and RAP1GAP. It promotes cell growth in glioma cells via RAF1 phosphorylation or CDKN1A upregulation, while inducing cell cycle arrest in PMA-stimulated intestinal cells. During macrophage differentiation, it translocates to the nucleus and modulates desmosomal adhesion post-wounding. PKC alpha enhances cell motility by phosphorylating CSPG4 and is overexpressed in cancers, acting as an oncogene. It negatively regulates myocardial contractility but positively controls angiogenesis and platelet aggregation. The kinase phosphorylates cardiac troponin T (TNNT2/CTNT) to reduce myocardial contractility and stabilizes VEGFA mRNA to promote angiogenesis. In platelets, it mediates granule release via CD36/GP4 and activates ITGA2B-ITGB3 integrin through RAP1GAP. PKC alpha also modulates LPS-induced macrophage functions and negatively regulates NF-κB via IL1A-dependent NFKBIA induction. It phosphorylates EIF4G1, KIT, and ATF2 to influence translation and transcription. Similar functions (By similarity) include SOCS2 phosphorylation for degradation and KLHL3 phosphorylation to disrupt WNK4 binding. Recent studies (PubMed:36040231) show it activates LRRK1 to regulate RAB proteins in intracellular trafficking.

Verified Bioactivity

The activity of PKCα is verified by the ADP-Glo method: Incubate PKCα protein, ATP, and the substrate at room temperature for 40 minutes, then add the ADP-Glo reagent and read the luminescence signal using the chemiluminescence module of the microplate reader.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag N-GST
  • Accession
  • Gene ID
  • Protein Length

    Full Length

  • Synonyms

    PRKCA; PRKCA Protein; Prev. PKCA; PKCI+/-; Protein Kinase C Alpha Type; PRKACA; Protein Kinase C, Alpha; PKC-A; PKC-Alpha; PKCα; Aging-Associated Gene 6; AAG6; Protein Kinase C; Protein Kinase C Alpha; PKCalpha

  • AA Sequence

    ADVFPGNDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGSLLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRLSVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNMELRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIADFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKSLSKEAVSVCKGLMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFVHPILQSAV

  • Predicted Molecular Mass

    103.2 kDa

  • Molecular Weight

    Approximately 103 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Formulation

1.Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, 150 mM NaCl, 5% glycerol, 5 mM DTT, 0.1 M trehalose, pH 7.5.
2.Supplied as a 0.22 μm filtered solution of 20 mM HEPES, pH 7.4, 150 mM NaCl.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00