1. Recombinant Proteins
  2. Enzymes & Regulators Kinases
  3. Transferases (EC 2) Serine/Threonine Kinase Proteins AGC
  4. PKC
  5. PRKCA/PKC alpha
  6. PRKCA Protein, Human (Active, sf9, GST)

PRKCA Protein, Human (sf9, GST) is the recombinant human-derived PRKCA, expressed by Sf9 insect cells , with N-GST labeled tag. ,

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

1 Publications Citing Use of MCE PRKCA Protein, Human (Active, sf9, GST)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PRKCA Protein, Human (sf9, GST) is the recombinant human-derived PRKCA, expressed by Sf9 insect cells , with N-GST labeled tag. ,

Background

PKC alpha is a calcium-activated, phospholipid- and diacylglycerol (DAG)-dependent serine/threonine-protein kinase that regulates cell proliferation, apoptosis, differentiation, migration, adhesion, tumorigenesis, cardiac hypertrophy, angiogenesis, platelet function, and inflammation by directly phosphorylating targets like RAF1, BCL2, CSPG4, and TNNT2/CTNT or activating signaling cascades involving MAPK1/3 (ERK1/2) and RAP1GAP. It promotes cell growth in glioma cells via RAF1 phosphorylation or CDKN1A upregulation, while inducing cell cycle arrest in PMA-stimulated intestinal cells. During macrophage differentiation, it translocates to the nucleus and modulates desmosomal adhesion post-wounding. PKC alpha enhances cell motility by phosphorylating CSPG4 and is overexpressed in cancers, acting as an oncogene. It negatively regulates myocardial contractility but positively controls angiogenesis and platelet aggregation. The kinase phosphorylates cardiac troponin T (TNNT2/CTNT) to reduce myocardial contractility and stabilizes VEGFA mRNA to promote angiogenesis. In platelets, it mediates granule release via CD36/GP4 and activates ITGA2B-ITGB3 integrin through RAP1GAP. PKC alpha also modulates LPS-induced macrophage functions and negatively regulates NF-κB via IL1A-dependent NFKBIA induction. It phosphorylates EIF4G1, KIT, and ATF2 to influence translation and transcription. Similar functions (By similarity) include SOCS2 phosphorylation for degradation and KLHL3 phosphorylation to disrupt WNK4 binding. Recent studies (PubMed:36040231) show it activates LRRK1 to regulate RAB proteins in intracellular trafficking.

Biological Activity

The activity of PKCα is verified by the ADP-Glo method: Incubate PKCα protein, ATP, and the substrate at room temperature for 40 minutes, then add the ADP-Glo reagent and read the luminescence signal using the chemiluminescence module of the microplate reader.

Species

Human

Source

Sf9 insect cells

Tag

N-GST

Accession

P17252 (A2-V672)

Gene ID

5578

Protein Length

Full Length of Mature Protein

Synonyms
PRKCA; protein kinase C alpha; AAG6; PKCA; PRKACA; PKCI+/-; PKCalpha; PKC-alpha
AA Sequence

ADVFPGNDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGSLLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRLSVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNMELRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIADFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKSLSKEAVSVCKGLMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFVHPILQSAV

Molecular Weight

103.2 kDa

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, 150 mM NaCl, 5% glycerol, 5 mM DTT, 0.1 M trehalose, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PRKCA Protein, Human (Active, sf9, GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PRKCA Protein, Human (Active, sf9, GST)
Cat. No.:
HY-P702641
Quantity:
MCE Japan Authorized Agent: