PRKCB1 Protein, Human (Active, sf9, GST)

PRKCB1 Protein, Human (sf9, GST) is the recombinant human-derived PRKCB, expressed by Sf9 insect cells , with GST labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

PRKCB1 Protein, Human (sf9, GST) is the recombinant human-derived PRKCB, expressed by Sf9 insect cells , with GST labeled tag.

Background

PKC beta 1 is a calcium-activated, phospholipid- and diacylglycerol (DAG)-dependent serine/threonine-protein kinase involved in various cellular processes, including regulation of the B-cell receptor (BCR) signalosome, oxidative stress-induced apoptosis, androgen receptor-dependent transcription regulation, insulin signaling, and endothelial cell proliferation. It plays a key role in B-cell activation by regulating BCR-induced NF-kappa-B activation. PKC beta 1 mediates the activation of the canonical NF-kappa-B pathway (NFKB1) by directly phosphorylating CARD11/CARMA1 at 'Ser-559', 'Ser-644', and 'Ser-652'. Additionally, it negatively regulates BCR signaling by phosphorylating BTK at 'Ser-180', inhibiting BTK activity. In apoptosis following oxidative damage, PKC beta 1 specifically phosphorylates 'Ser-36' of the p66Shc isoform of SHC1, leading to mitochondrial accumulation of p66Shc and reactive oxygen species production. As a coactivator of androgen receptor (AR)-dependent transcription, PKC beta 1 is recruited to AR target genes and phosphorylates histone H3 at 'Thr-6' (H3T6ph), preventing demethylation of histone H3 'Lys-4' (H3K4me) by LSD1/KDM1A. In insulin signaling, PKC beta 1 may function downstream of IRS1 and mediate insulin-dependent DNA synthesis through the RAF1-MAPK/ERK cascade. It also negatively modulates insulin-stimulated translocation of the glucose transporter SLC2A4/GLUT4 in adipocytes. PKC beta 1 phosphorylates SLC2A1/GLUT1, promoting glucose uptake. Under high glucose conditions, it likely inhibits insulin gene transcription in pancreatic beta-cells via regulation of MYC expression. In endothelial cells, PKC beta 1 activation increases RB1 phosphorylation, enhances VEGFA-induced proliferation, and inhibits PI3K/AKT-dependent nitric oxide synthase (NOS3/eNOS) regulation, contributing to endothelial dysfunction. PKC beta 1 is also involved in triglyceride homeostasis (by similar). It phosphorylates ATF2, promoting ATF2-JUN cooperation and transcriptional activation. In angiotensin II signaling, PKC beta 1 phosphorylates KLHL3, reducing its interaction with WNK4. Additionally, it phosphorylates and activates LRRK1, which in turn phosphorylates RAB proteins involved in intracellular trafficking.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag GST
  • Accession
  • Gene ID
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    PRKCB; PKC-B; Prev. PRKCB1; Protein Kinase C, Beta 1; Prev. PKCB; Protein Kinase C, Beta; Prev. PRKCB2; PKCI(2); Protein Kinase C Beta Type; PKCbeta; PKC-Beta; PKCβ; Protein Kinase C Beta; Protein Kinase C, Beta 1 Polypeptide

  • AA Sequence

    ADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDRDVLIVLVRDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKASVDGWFKLLSQEEGEYFNVPVPPEGSEANEELRQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLERKEIQPPYKPKARDKRDTSNFDKEFTRQPVELTPTDKLFIMNLDQNEFAGFSYTNPEFVINV

  • Purity

    ≥ 80%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00