1. Recombinant Proteins
  2. Enzymes & Regulators Kinases
  3. Transferases (EC 2) Serine/Threonine Kinase Proteins AGC
  4. PKC
  5. PRKCB/PKC beta
  6. PRKCB1 Protein, Human (Active, sf9, GST)

PRKCB1 Protein, Human (sf9, GST) is the recombinant human-derived PRKCB, expressed by Sf9 insect cells , with GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
50 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PRKCB1 Protein, Human (sf9, GST) is the recombinant human-derived PRKCB, expressed by Sf9 insect cells , with GST labeled tag.

Background

PKC beta 1 is a calcium-activated, phospholipid- and diacylglycerol (DAG)-dependent serine/threonine-protein kinase involved in various cellular processes, including regulation of the B-cell receptor (BCR) signalosome, oxidative stress-induced apoptosis, androgen receptor-dependent transcription regulation, insulin signaling, and endothelial cell proliferation. It plays a key role in B-cell activation by regulating BCR-induced NF-kappa-B activation. PKC beta 1 mediates the activation of the canonical NF-kappa-B pathway (NFKB1) by directly phosphorylating CARD11/CARMA1 at 'Ser-559', 'Ser-644', and 'Ser-652'. Additionally, it negatively regulates BCR signaling by phosphorylating BTK at 'Ser-180', inhibiting BTK activity. In apoptosis following oxidative damage, PKC beta 1 specifically phosphorylates 'Ser-36' of the p66Shc isoform of SHC1, leading to mitochondrial accumulation of p66Shc and reactive oxygen species production. As a coactivator of androgen receptor (AR)-dependent transcription, PKC beta 1 is recruited to AR target genes and phosphorylates histone H3 at 'Thr-6' (H3T6ph), preventing demethylation of histone H3 'Lys-4' (H3K4me) by LSD1/KDM1A. In insulin signaling, PKC beta 1 may function downstream of IRS1 and mediate insulin-dependent DNA synthesis through the RAF1-MAPK/ERK cascade. It also negatively modulates insulin-stimulated translocation of the glucose transporter SLC2A4/GLUT4 in adipocytes. PKC beta 1 phosphorylates SLC2A1/GLUT1, promoting glucose uptake. Under high glucose conditions, it likely inhibits insulin gene transcription in pancreatic beta-cells via regulation of MYC expression. In endothelial cells, PKC beta 1 activation increases RB1 phosphorylation, enhances VEGFA-induced proliferation, and inhibits PI3K/AKT-dependent nitric oxide synthase (NOS3/eNOS) regulation, contributing to endothelial dysfunction. PKC beta 1 is also involved in triglyceride homeostasis (by similar). It phosphorylates ATF2, promoting ATF2-JUN cooperation and transcriptional activation. In angiotensin II signaling, PKC beta 1 phosphorylates KLHL3, reducing its interaction with WNK4. Additionally, it phosphorylates and activates LRRK1, which in turn phosphorylates RAB proteins involved in intracellular trafficking.

Species

Human

Source

Sf9 insect cells

Tag

GST

Accession

P05771-1 (A2-V671)

Gene ID

5579

Protein Length

Full Length of Isoform-1

Synonyms
PRKCB1; protein kinase C, beta; PKCB, PRKCB1, PRKCB2, protein kinase C, beta 1; protein kinase C beta type; PKC-B; protein kinase C, beta 1 polypeptide; PKCB; PRKCB1; PRKCB2; PKC-beta; MGC41878
AA Sequence

ADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDRDVLIVLVRDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKASVDGWFKLLSQEEGEYFNVPVPPEGSEANEELRQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLERKEIQPPYKPKARDKRDTSNFDKEFTRQPVELTPTDKLFIMNLDQNEFAGFSYTNPEFVINV

Purity

≥ 80%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PRKCB1 Protein, Human (Active, sf9, GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PRKCB1 Protein, Human (Active, sf9, GST)
Cat. No.:
HY-P702639
Quantity:
MCE Japan Authorized Agent: