PXR Protein, Human (His)

Customer Review

Based on 1 Customer Validation

The PXR protein is a nuclear receptor that acts as a multifunctional transcription factor activated by a variety of endogenous and exogenous compounds. It regulates genes involved in the metabolism and secretion of substances, responding to ligands such as rifampicin, hypericin, gugulin, colupulone, isoflavones, pregnenolone and progesterone. PXR Protein, Human (His) is the recombinant human-derived PXR protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The PXR protein is a nuclear receptor that acts as a multifunctional transcription factor activated by a variety of endogenous and exogenous compounds. It regulates genes involved in the metabolism and secretion of substances, responding to ligands such as rifampicin, hypericin, gugulin, colupulone, isoflavones, pregnenolone and progesterone. PXR Protein, Human (His) is the recombinant human-derived PXR protein, expressed by E. coli , with N-6*His labeled tag.

Background

PXR Protein, a nuclear receptor, serves as a versatile transcription factor activated by a range of endogenous and xenobiotic compounds. It plays a pivotal role in regulating the transcription of multiple genes involved in the metabolism and secretion of potentially harmful substances, including xenobiotics, drugs, and endogenous compounds. Activated by various ligands such as the antibiotic rifampicin, as well as plant metabolites like hyperforin, guggulipid, colupulone, and isoflavones, the response to specific ligands is species-specific. PXR is also activated by naturally occurring steroids, including pregnenolone and progesterone. It binds to response elements in the promoters of key genes such as CYP3A4 and ABCB1/MDR1. Operating in association with RXR, PXR forms heterodimers and interacts with coactivator NCOA1. Moreover, PXR engages in ligand-dependent interactions with the clock proteins CRY1 and CRY2 through its NR LBD domain, adding another layer of complexity to its regulatory functions.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • PXR (S130-S434)
      Accession # O75469
    • C-term
  • Protein Length

    Partial

  • Synonyms

    NR1I2; Steroid And Xenobiotic Receptor; Nuclear Receptor Subfamily 1 Group I Member 2; Orphan Nuclear Receptor PAR1; Orphan Nuclear Receptor PXR; Nuclear Receptor Subfamily 1, Group I, Member 2; Pregnane X Receptor; PARq; PAR2; PAR1; SXR; SAR; PXR; PRR; O

  • AA Sequence

    SERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWECGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGS

  • Molecular Weight

    Approximately 39 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM HEPES, 200 mM NaCl, 20% glycerol, pH 7.5, 1 mM DTT.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00