ACVR2A/Activin RIIA Protein, Rat (HEK293, His)
Based on 1 Customer Validation
ACVR2A/Activin RIIA Protein, Rat (HEK293, His) is the recombinant rat-derived RIIA/ACVR2A protein, expressed by HEK293, with C-His tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
ACVR2A/Activin RIIA Protein, Rat (HEK293, His) is the recombinant rat-derived RIIA/ACVR2A protein, expressed by HEK293, with C-His tag.
Background
RIIA/ACVR2A is a transmembrane serine/threonine kinase receptor that forms a complex consisting of two type II and two type I receptors upon ligand binding. Type II receptors phosphorylate and activate type I receptors, which then autophosphorylate, bind, and activate SMAD transcriptional regulators. It serves as a receptor for activin A, activin B, and inhibin A, and mediates adipogenesis induction by GDF6. by similar: This mechanism is analogous to signaling by other TGF-β superfamily receptors.
Verified Bioactivity
1.This product does not contain protein kinase domain.
2.Measured by its binding ability in a functional ELISA. Immobilized Human Activin A, No Tag at 2μg/ml (100μl/well) on the plate can bind Rat Activin RIIA, His Tag. The ED50 is 0.36 μg/mL.
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-8*His
-
Accession
P38444 (A20-P135)
-
Gene ID29263
-
Protein Length
Extracellular Domain
-
Synonyms
ACVR2A; Activin Receptor Type-2A; Prev. ACVR2; Activin Receptor Type IIA; ACTRII; ACTR-IIA; Activin A Receptor, Type IIA; ACTRIIA; Activin A Receptor Type 2A; Activin A Receptor, Type II
-
AA Sequence
AILGRSETQECLFFNANWERDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCIEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPP
-
Predicted Molecular Mass
15.1 kDa
-
Molecular Weight
Approximately 35-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
