1. Recombinant Proteins
  2. Receptor Proteins Enzymes & Regulators
  3. Cytokine Receptors Serine/Threonine Kinase Proteins
  4. ACVR2A/Activin RIIA Protein, Rat (HEK293, His)

ACVR2A/Activin RIIA Protein, Rat (HEK293, His)

Cat. No.: HY-P703683
Handling Instructions Technical Support

ACVR2A/Activin RIIA Protein, Rat (HEK293, His) is the recombinant rat-derived RIIA/ACVR2A protein, expressed by HEK293, with C-His tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ACVR2A/Activin RIIA Protein, Rat (HEK293, His) is the recombinant rat-derived RIIA/ACVR2A protein, expressed by HEK293, with C-His tag.

Background

RIIA/ACVR2A is a transmembrane serine/threonine kinase receptor that forms a complex consisting of two type II and two type I receptors upon ligand binding. Type II receptors phosphorylate and activate type I receptors, which then autophosphorylate, bind, and activate SMAD transcriptional regulators. It serves as a receptor for activin A, activin B, and inhibin A, and mediates adipogenesis induction by GDF6. by similar: This mechanism is analogous to signaling by other TGF-β superfamily receptors.

Biological Activity

1.This product does not contain protein kinase domain.
2.Measured by its binding ability in a functional ELISA. Immobilized Human Activin A, No Tag at 2μg/ml (100μl/well) on the plate can bind Rat Activin RIIA, His Tag. The ED50 is 0.36 μg/mL.

Species

Rat

Source

HEK293

Tag

C-8*His

Accession

P38444 (A20-P135)

Gene ID

29263

Protein Length

Extracellular Domain

Synonyms
Activin receptor type-2A; Activin receptor type IIA; ACTR-IIA; Acvr2a; ACTR-IIA
AA Sequence

AILGRSETQECLFFNANWERDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCIEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPP

Molecular Weight

Predicted band size: 15.06 kDa; Observed band size: 35-45 kDa.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ACVR2A/Activin RIIA Protein, Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

ACVR2A/Activin RIIA Protein, Rat (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ACVR2A/Activin RIIA Protein, Rat (HEK293, His)
Cat. No.:
HY-P703683
Quantity:
MCE Japan Authorized Agent: