ACVR2A/Activin RIIA Protein, Rat (HEK293, His)

ACVR2A/Activin RIIA Protein, Rat (HEK293, His) is the recombinant rat-derived RIIA/ACVR2A protein, expressed by HEK293, with C-His tag.

RIIA/ACVR2A is a transmembrane serine/threonine kinase receptor that forms a complex consisting of two type II and two type I receptors upon ligand binding. Type II receptors phosphorylate and activate type I receptors, which then autophosphorylate, bind, and activate SMAD transcriptional regulators. It serves as a receptor for activin A, activin B, and inhibin A, and mediates adipogenesis induction by GDF6. by similar: This mechanism is analogous to signaling by other TGF-β superfamily receptors.

1.This product does not contain protein kinase domain.
2.Measured by its binding ability in a functional ELISA. Immobilized Human Activin A, No Tag at 2μg/ml (100μl/well) on the plate can bind Rat Activin RIIA, His Tag. The ED₅₀ is 0.36 μg/mL.

Rat

HEK293

C-8*His

P38444 (A20-P135)

29263

Extracellular Domain

AILGRSETQECLFFNANWERDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCIEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPP

Predicted band size: 15.06 kDa; Observed band size: 35-45 kDa.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.