ROCK1 Protein, Human (Active, sf9)

Customer Review

Based on 1 Customer Validation

The ROCK1 protein is a key kinase that regulates the actin cytoskeleton, cell polarity, smooth muscle contraction, and multiple cellular functions. It controls stress fibers, focal adhesion formation, neurite retraction, and cell motility by phosphorylating substrates such as DAPK3, GFAP, LIMK1, LIMK2, MYL9/MLC2, TPPP, PFN1, and PPP1R12A. ROCK1 Protein, Human (sf9) is the recombinant human-derived ROCK1 protein, expressed by sf9 insect cells , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The ROCK1 protein is a key kinase that regulates the actin cytoskeleton, cell polarity, smooth muscle contraction, and multiple cellular functions. It controls stress fibers, focal adhesion formation, neurite retraction, and cell motility by phosphorylating substrates such as DAPK3, GFAP, LIMK1, LIMK2, MYL9/MLC2, TPPP, PFN1, and PPP1R12A. ROCK1 Protein, Human (sf9) is the recombinant human-derived ROCK1 protein, expressed by sf9 insect cells , with tag free.

Background

ROCK1 protein stands as a pivotal kinase, wielding key regulatory influence over the actin cytoskeleton and cellular polarity. Demonstrating a broad spectrum of cellular functions, ROCK1 intricately governs smooth muscle contraction, actin cytoskeleton organization, stress fiber and focal adhesion formation, neurite retraction, cell adhesion, and motility through the phosphorylation of diverse substrates such as DAPK3, GFAP, LIMK1, LIMK2, MYL9/MLC2, TPPP, PFN1, and PPP1R12A. It collaborates with FHOD1 to induce SRC-dependent non-apoptotic plasma membrane blebbing and phosphorylates JIP3, regulating the recruitment of JNK to JIP3 during UVB-induced stress. As a suppressor of inflammatory cell migration, ROCK1 influences PTEN phosphorylation and stability, while concurrently acting as a negative regulator of VEGF-induced angiogenic endothelial cell activation. Crucially involved in centrosome positioning and mitotic exit, ROCK1 plays roles in terminal erythroid differentiation, inhibition of podocyte motility, promotion of keratinocyte terminal differentiation, and facilitation of osteoblast compaction during matrix assembly, contributing to osteoblast mineralization. Moreover, ROCK1 may impact eyelid and ventral body wall closure through the induction of actomyosin bundle assembly. The diverse roles of ROCK1 underscore its multifaceted impact on cellular physiology and highlight its regulatory significance in various cellular processes.

Verified Bioactivity

The activity of ROCK1 is verified by the ADP-Glo method: Incubate ROCK1 protein, ATP, and the substrate at room temperature for 40 minutes, then add the ADP-Glo reagent and read the luminescence signal using the chemiluminescence module of the microplate reader. When the protein concentration is 7.81 nM, the conversion rate is about 20%.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • ROCK1 (S6-R415)
      Accession # Q13464
    • C-term
  • Protein Length

    Partial

  • Synonyms

    ROCK1; Rho-Associated, Coiled-Coil-Containing Protein Kinase 1; Rho Associated Coiled-Coil Containing Protein Kinase 1; Renal Carcinoma Antigen NY-REN-35; P160ROCK; ROCK-I; Rho-Associated Protein Kinase 1; Rho-Associated Protein Kinase; P160 ROCK-1; ROCK1

  • AA Sequence

    SFETRFEKMDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYKDTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTAEVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFPDDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLSSDIDTSNFDDLEEDKGEEETFPIPKAFVGNQLPFVGFTYYSNRRYLSSANPNDNR

  • Molecular Weight

    Approximately 48 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, 500 mM NaCl, 20% glycerol, 1 mM DTT, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00