ROCK1 Protein, Human (Active, sf9)
Based on 1 Customer Validation
The ROCK1 protein is a key kinase that regulates the actin cytoskeleton, cell polarity, smooth muscle contraction, and multiple cellular functions. It controls stress fibers, focal adhesion formation, neurite retraction, and cell motility by phosphorylating substrates such as DAPK3, GFAP, LIMK1, LIMK2, MYL9/MLC2, TPPP, PFN1, and PPP1R12A. ROCK1 Protein, Human (sf9) is the recombinant human-derived ROCK1 protein, expressed by sf9 insect cells , with tag free.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The ROCK1 protein is a key kinase that regulates the actin cytoskeleton, cell polarity, smooth muscle contraction, and multiple cellular functions. It controls stress fibers, focal adhesion formation, neurite retraction, and cell motility by phosphorylating substrates such as DAPK3, GFAP, LIMK1, LIMK2, MYL9/MLC2, TPPP, PFN1, and PPP1R12A. ROCK1 Protein, Human (sf9) is the recombinant human-derived ROCK1 protein, expressed by sf9 insect cells , with tag free.
Background
ROCK1 protein stands as a pivotal kinase, wielding key regulatory influence over the actin cytoskeleton and cellular polarity. Demonstrating a broad spectrum of cellular functions, ROCK1 intricately governs smooth muscle contraction, actin cytoskeleton organization, stress fiber and focal adhesion formation, neurite retraction, cell adhesion, and motility through the phosphorylation of diverse substrates such as DAPK3, GFAP, LIMK1, LIMK2, MYL9/MLC2, TPPP, PFN1, and PPP1R12A. It collaborates with FHOD1 to induce SRC-dependent non-apoptotic plasma membrane blebbing and phosphorylates JIP3, regulating the recruitment of JNK to JIP3 during UVB-induced stress. As a suppressor of inflammatory cell migration, ROCK1 influences PTEN phosphorylation and stability, while concurrently acting as a negative regulator of VEGF-induced angiogenic endothelial cell activation. Crucially involved in centrosome positioning and mitotic exit, ROCK1 plays roles in terminal erythroid differentiation, inhibition of podocyte motility, promotion of keratinocyte terminal differentiation, and facilitation of osteoblast compaction during matrix assembly, contributing to osteoblast mineralization. Moreover, ROCK1 may impact eyelid and ventral body wall closure through the induction of actomyosin bundle assembly. The diverse roles of ROCK1 underscore its multifaceted impact on cellular physiology and highlight its regulatory significance in various cellular processes.
Verified Bioactivity
The activity of ROCK1 is verified by the ADP-Glo method: Incubate ROCK1 protein, ATP, and the substrate at room temperature for 40 minutes, then add the ADP-Glo reagent and read the luminescence signal using the chemiluminescence module of the microplate reader. When the protein concentration is 7.81 nM, the conversion rate is about 20%.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag Tag Free
-
Accession
Q13464 (S6-R415)
-
Gene ID6093
-
Molecular Construction
-
N-term
-
ROCK1 (S6-R415)
Accession # Q13464 -
C-term
-
-
Protein Length
Partial
-
Synonyms
ROCK1; Rho-Associated, Coiled-Coil-Containing Protein Kinase 1; Rho Associated Coiled-Coil Containing Protein Kinase 1; Renal Carcinoma Antigen NY-REN-35; P160ROCK; ROCK-I; Rho-Associated Protein Kinase 1; Rho-Associated Protein Kinase; P160 ROCK-1; ROCK1
-
AA Sequence
SFETRFEKMDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYKDTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTAEVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFPDDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLSSDIDTSNFDDLEEDKGEEETFPIPKAFVGNQLPFVGFTYYSNRRYLSSANPNDNR
-
Molecular Weight
Approximately 48 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, 500 mM NaCl, 20% glycerol, 1 mM DTT, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (238 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)