S100A4 Protein, Human (C/N-His)
Based on 1 Customer Validation
The S100A4 protein is a calcium-binding protein involved in angiogenesis, cell differentiation, apoptosis, and autophagy. S100A4 protein interacts with MYH9 to enhance cell motility and invasion. S100A4 also inhibits the pro-apoptotic function of TP53 by reducing its protein levels. S100A4 Protein, Human (C/N-His) is the recombinant human-derived S100A4 protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The S100A4 protein is a calcium-binding protein involved in angiogenesis, cell differentiation, apoptosis, and autophagy. S100A4 protein interacts with MYH9 to enhance cell motility and invasion. S100A4 also inhibits the pro-apoptotic function of TP53 by reducing its protein levels. S100A4 Protein, Human (C/N-His) is the recombinant human-derived S100A4 protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.
Background
S100A4 protein, a calcium-binding molecule, plays a versatile role in numerous cellular processes, including motility, angiogenesis, cell differentiation, apoptosis, and autophagy. Functionally, it enhances cell motility and invasiveness by interacting with non-muscle myosin heavy chain IIA/MYH9, promoting filament depolymerization and increasing the amount of soluble myosin-IIA to facilitate chemotaxis. Additionally, S100A4 modulates the pro-apoptotic function of TP53 by binding to its C-terminal transactivation domain within the nucleus, leading to a reduction in TP53 protein levels. In the extracellular space, it stimulates cytokine production and acts as a chemoattractant complex with PGLYRP1 to promote lymphocyte migration via CCR5 and CXCR3 receptors. The protein forms homodimers and interacts with various partners, including PPFIBP1, Annexin 2/ANXA2, TP53, CCR5, and FCGR3A, each interaction contributing to its diverse cellular functions. This intricate network of interactions underscores the multifaceted role of S100A4 in orchestrating cellular responses across different pathways.
Verified Bioactivity
Measured in a cell proliferation assay using U87 cells. The ED50 for this effect is 22.81 ng/mL, corresponding to a specific activity is 4.384×10^4 units/mg.
MCE Validation Data
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His;C-6*His
-
Accession
P26447 (M1-K101)
-
Molecular Construction
-
N-term
-
6*His
-
S100A4 (M1-K101)
Accession # P26447 -
6*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
S100A4; Fibroblast-Specific Protein-1; Prev. CAPL; Murine Placental Homolog; Prev. MTS1; Protein S100-A4; PEL98; Metastasin 1; P9KA; Protein Mts1; 18A2; Calvasculin; FSP1; Leukemia Multidrug Resistance Associated Protein; 42A; Malignant Transformation Sup
-
AA Sequence
MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK
-
Predicted Molecular Mass
13.8 kDa
-
Molecular Weight
Approximately 13 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 300 mM NaCl, 5% trehalose, 5% mannitol and 0.01% Tween 80, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (260 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
