S100A7A Protein, Human (P.pastoris, His)
The S100A7A protein plays potential roles in skin homeostasis, epidermal differentiation, and inflammation, suggesting its importance in skin health and disease. Its involvement in cellular functions makes it a key factor in diseases such as psoriasis, which is characterized by abnormal epidermal processes and inflammation. S100A7A Protein, Human (P.pastoris, His) is the recombinant human-derived S100A7A protein, expressed by P. pastoris , with N-His labeled tag.
- Species: Human
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The S100A7A protein plays potential roles in skin homeostasis, epidermal differentiation, and inflammation, suggesting its importance in skin health and disease. Its involvement in cellular functions makes it a key factor in diseases such as psoriasis, which is characterized by abnormal epidermal processes and inflammation. S100A7A Protein, Human (P.pastoris, His) is the recombinant human-derived S100A7A protein, expressed by P. pastoris , with N-His labeled tag.
Background
S100A7A Protein emerges as a potential player in epidermal differentiation and inflammation, suggesting a pivotal role in the intricate processes that contribute to skin homeostasis and immune response. Its implication in these cellular functions positions S100A7A as a potentially significant factor in the pathogenesis of diseases such as psoriasis, where aberrant epidermal differentiation and inflammation play key roles. The dual involvement in epidermal processes and inflammatory responses underscores the potential multifaceted impact of S100A7A on skin health and disease. Further exploration of its specific mechanisms and interactions may deepen our understanding of S100A7A's role in skin physiology and its potential implications in various pathological contexts, particularly those related to skin disorders and inflammatory conditions.
Technical Parameters
-
Species Human
-
Source P. pastoris
-
Tag N-His
-
Accession
Q86SG5 (S2-Q101)
-
Molecular Construction
-
N-term
-
His
-
S100A7A (S2-Q101)
Accession # Q86SG5 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
S100A7A; Protein S100-A7A; Prev. S100A7L1; S100 Calcium Binding Protein A7-Like 1; Prev. S100A15; S100 Calcium Binding Protein A15; S100A7f; S100 Calcium-Binding Protein A7A; S100 Calcium-Binding Protein A7-Like 1; NICE-2; S100 Calcium-Binding Protein A15
-
AA Sequence
SNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFEKKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPCSGGSQ
-
Predicted Molecular Mass
13.2 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
