SECTM1 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

SECTM1 Protein potentially influences thymocyte signaling, indicating a role in thymic regulatory mechanisms. Its interaction with CD7 suggests involvement in cellular processes, potentially influencing thymocyte-associated signaling pathways. SECTM1's significance in thymocyte function and interaction with CD7 hints at a role in modulating immune responses and cellular communication within the thymic microenvironment. SECTM1 Protein, Human (HEK293, His) is the recombinant human-derived SECTM1 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

SECTM1 Protein potentially influences thymocyte signaling, indicating a role in thymic regulatory mechanisms. Its interaction with CD7 suggests involvement in cellular processes, potentially influencing thymocyte-associated signaling pathways. SECTM1's significance in thymocyte function and interaction with CD7 hints at a role in modulating immune responses and cellular communication within the thymic microenvironment. SECTM1 Protein, Human (HEK293, His) is the recombinant human-derived SECTM1 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The SECTM1 protein appears to play a potential role in thymocyte signaling, suggesting its involvement in the complex regulatory mechanisms within the thymus. Its interaction with CD7 further underscores its role in these cellular processes, hinting at a possible influence on the signaling pathways associated with thymocytes. The significance of SECTM1 in the context of thymocyte function and its interaction with CD7 implies a potential role in modulating immune responses and cellular communication within the thymic microenvironment.

Verified Bioactivity

1.Recombinant Human SECTM1 (C-6His). The ED50 of Recombinant Human SECTM1 (C-6His) is 25.15 ng/ml.
2.Immobilized Recombinant Human CD7 (C-Fc) at 1 μg/mL (100 μL/well) can bind Recombinant Human SECTM1 (C-6His). The ED50 of Recombinant Human SECTM1 (C-6His) is 27.56 ng/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • SECTM1 (Q29-G145)
      Accession # Q8WVN6
    • 6*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    SECTM1; Type 1a Transmembrane Protein; Secreted And Transmembrane 1; Protein K-12; K12; K12 Protein; Secreted And Transmembrane Protein 1; SECTM

  • AA Sequence

    QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTG

  • Predicted Molecular Mass

    13.8 kDa

  • Molecular Weight

    Approximately 18-23 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00