SAA1/Serum Amyloid A-1 Protein, Mouse
Based on 1 Customer Validation
Serum Amyloid A-1 Protein, a vital acute phase protein, primarily exists as a homohexamer composed of dimers of trimers.Although it can form amyloid fibrils after partial proteolysis, the native, undenatured form does not exhibit amyloid fibril formation in vitro.Serving as an apolipoprotein within the HDL complex, Serum Amyloid A-1 also shows affinity for heparin binding, highlighting its multifaceted role in biological processes.SAA1/Serum Amyloid A-1 Protein, Mouse is the recombinant mouse-derived Serum Amyloid A-1 protein, expressed by E.coli , with tag free.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Serum Amyloid A-1 Protein, a vital acute phase protein, primarily exists as a homohexamer composed of dimers of trimers.Although it can form amyloid fibrils after partial proteolysis, the native, undenatured form does not exhibit amyloid fibril formation in vitro.Serving as an apolipoprotein within the HDL complex, Serum Amyloid A-1 also shows affinity for heparin binding, highlighting its multifaceted role in biological processes.SAA1/Serum Amyloid A-1 Protein, Mouse is the recombinant mouse-derived Serum Amyloid A-1 protein, expressed by E.coli , with tag free.
Background
Serum Amyloid A-1 Protein emerges as a significant acute phase protein, existing primarily as a homohexamer composed of dimers of trimers. While it has the potential to form amyloid fibrils after partial proteolysis, it's noteworthy that the native, undenatured form of the protein does not exhibit amyloid fibril formation in vitro. Additionally, Serum Amyloid A-1 serves a crucial role as an apolipoprotein within the HDL complex and demonstrates affinity for heparin binding, underscoring its multifaceted nature in biological processes.
Verified Bioactivity
Measured by its ability to induce TNF-alpha secretion by J774A.1 mouse reticulum cell sarcoma macrophage cells. The ED50 for this effect is 1.0-3.0 μg/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag Tag Free
-
Accession
P05366 (G20-Y122)
-
Molecular Construction
-
N-term
-
SAA1 (G20-Y122)
Accession # P05366 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
SAA1; PIG4; Prev. SAA; Serum Amyloid A Protein; TP53I4; Tumor Protein P53 Inducible Protein 4; Serum Amyloid A1; Serum Amyloid A-1 Protein
-
AA Sequence
GFFSFVHEAFQGAGDMWRAYTDMKEANWKNSDKYFHARGNYDAAQRGPGGVWAAEKISDGREAFQEFFGRGHEDTIADQEANRHGRSGKDPNYYRPPGLPDKY
-
Molecular Weight
Approximately 11 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4
2. Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)