SHH Protein, Mouse (HEK293)

Customer Review

Based on 1 Customer Validation

SHH Protein, Mouse (HEK293) is a morphogenic factor that actively orchestrates many aspects of cerebellar development and maturation.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

SHH Protein, Mouse (HEK293) is a morphogenic factor that actively orchestrates many aspects of cerebellar development and maturation.

Background

Sonic hedgehog (Shh) is a morphogenic factor that actively orchestrates many aspects of cerebellar development and maturation[1]. Sonic hedgehog (Shh) plays a critical role in post-natal skeletal muscle regeneration. Sonic hedgehog (Shh) is a crucial morphogen that regulates epithelial-mesenchymal interactions during embryogenesis. In adults, the Shh pathway has been shown to be up-regulated following skeletal muscle and myocardium ischemia, suggesting that the embryonic Shh pathway can be recruited[2].

Verified Bioactivity

Measured by its ability to induce alkaline phosphatase production by C3H10T1/2 mouse embryonic fibroblast cells. The ED50 for this effect is 0.1110-0.1969 μg/mL.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • SHH (C25-G198)
      Accession # Q62226
    • C-term
  • Protein Length

    Partial

  • Synonyms

    SHH; Shh Unprocessed N-Terminal Signaling And C-Terminal Autoprocessing Domains; Prev. HLP3; Sonic Hedgehog Protein; Prev. HPE3; ShhNC; MCOPCB5; Sonic Hedgehog (Drosophila) Homolog; SMMCI; Sonic Hedgehog Homolog; TPTPS; Hedgehog Protein; HHG1; HHG-1; TPT;

  • AA Sequence

    CGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG

  • Predicted Molecular Mass

    19.6 kDa

  • Molecular Weight

    Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00