Copy Link Print Information

STC1/Stanniocalcin-1 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

STC1/Stanniocalcin-1 Proteinas, a homodimer, crucially stimulates renal phosphate reabsorption, safeguarding against hypercalcemia. Disulfide linkages contribute to its structural integrity. Its role in renal processes underscores significance in regulating phosphate levels, emphasizing a key role in maintaining mineral homeostasis. STC1/Stanniocalcin-1 Protein, Human (HEK293, His) is the recombinant human-derived STC1/Stanniocalcin-1 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for STC1/Stanniocalcin-1 Protein, Human (HEK293, His)
  • Experimental Validation Results for STC1/Stanniocalcin-1 Protein, Human (HEK293, His)
  • STC1/Stanniocalcin-1 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

STC1/Stanniocalcin-1 Proteinas, a homodimer, crucially stimulates renal phosphate reabsorption, safeguarding against hypercalcemia. Disulfide linkages contribute to its structural integrity. Its role in renal processes underscores significance in regulating phosphate levels, emphasizing a key role in maintaining mineral homeostasis. STC1/Stanniocalcin-1 Protein, Human (HEK293, His) is the recombinant human-derived STC1/Stanniocalcin-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

STC1, also known as Stanniocalcin-1 protein, plays a crucial role in stimulating renal phosphate reabsorption, thereby offering a potential safeguard against hypercalcemia. The protein functions as a homodimer, with disulfide linkages contributing to its structural integrity and functional activity. Its involvement in renal processes highlights its significance in the intricate regulation of phosphate levels, suggesting a key role in maintaining mineral homeostasis.

Verified Bioactivity

1.Measured in a cell proliferation assay using MCF-7 cells. The ED50 for this effect is 1.019 ng/mL, corresponding to a specific activity is 9.81×105 U/mg.
2.Measured by its ability to inhibit Wnt-3a-induced alkaline phosphatase production by MC3T3-E1 mouse preosteoblast cells. The ED50 for this effect is 30-100 ng/mL in the presence of 10 ng/mL of Recombinant Mouse Wnt-3a.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using MCF-7 cells. The ED50 for this effect is 1.019 ng/mL, corresponding to a specific activity is 9.81×105 U/mg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    P52823-1 (T18-A247)

  • Gene ID
    6781  [NCBI]
  • Molecular Construction
    • N-term
    • STC1 (T18-A247)
      Accession # P52823
    • 6*His
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    STC1; Stanniocalcin-1; Prev. STC; Stanniocalcin 1; STC-1

  • AA Sequence

    THEAEQNDSVSPRKSRVAAQNSAEVVRCLNSALQVGCGAFACLENSTCDTDGMYDICKSFLYSAAKFDTQGKAFVKESLKCIANGVTSKVFLAIRRCSTFQRMIAEVQEECYSKLNVCSIAKRNPEAITEVVQLPNHFSNRYYNRLVRSLLECDEDTVSTIRDSLMEKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEEDSPSHIKRTSHESA

  • Predicted Molecular Mass

    26.9 kDa

  • Molecular Weight

    Approximately 28-36 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using MCF-7 cells. The ED50 for this effect is 1.019 ng/mL, corresponding to a specific activity is 9.81×105 U/mg.

  • STC1/Stanniocalcin-1 Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for STC1/Stanniocalcin-1 Protein, Human (HEK293, His)
  • Experimental Validation Results for STC1/Stanniocalcin-1 Protein, Human (HEK293, His)
  • STC1/Stanniocalcin-1 Protein, Human (HEK293, His) Product Image