Thioredoxin/TXN Protein, Human (Solution)
Thioredoxin/TXN protein participates in multiple redox reactions, utilizing its active center dithiol for reversible oxidation and disulfide bond formation. It catalyzes important dithiol-disulfide exchange and plays a key role in S-nitrosylation of cysteine residues in response to intracellular nitric oxide. Thioredoxin/TXN Protein, Human (Solution) is the recombinant human-derived Thioredoxin/TXN protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
Thioredoxin/TXN protein participates in multiple redox reactions, utilizing its active center dithiol for reversible oxidation and disulfide bond formation. It catalyzes important dithiol-disulfide exchange and plays a key role in S-nitrosylation of cysteine residues in response to intracellular nitric oxide. Thioredoxin/TXN Protein, Human (Solution) is the recombinant human-derived Thioredoxin/TXN protein, expressed by E. coli , with tag free.
Background
Thioredoxin/TXN Protein actively engages in diverse redox reactions, employing the reversible oxidation of its active center dithiol to form a disulfide bond, and catalyzes crucial dithiol-disulfide exchange reactions. Beyond its classical redox functions, Thioredoxin plays a pivotal role in the reversible S-nitrosylation of cysteine residues within target proteins, contributing to the cellular response to intracellular nitric oxide. Notably, it exerts regulatory control over caspase-3 activity by nitrosylating the active site cysteine of CASP3 in response to nitric oxide. Moreover, Thioredoxin demonstrates its influence on the FOS/JUN AP-1 DNA-binding activity in ionizing radiation cells, modulating AP-1 transcriptional activity through its oxidation/reduction status. Additionally, Thioredoxin is implicated in the augmentation of interleukin-2 receptor TAC (IL2R/P55) expression, highlighting its multifaceted role in cellular processes beyond redox regulation.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P10599 (M1-V105)
-
Molecular Construction
-
N-term
-
TXN (M1-V105)
Accession # P10599 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
TXN; TRDX; TRX; TRX1; Thioredoxin; Trx; ATL-derived factor; ADF; Surface-associated sulphydryl protein; SASP; TXN Delta 3; Thioredoxin-2; Allergen Hom S Trx; Thioredoxin Delta 3; Thioredoxin, Mitochondrial; Testicular Tissue Protein Li 199; ADF; Surface-A
-
AA Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
-
Predicted Molecular Mass
11.7 kDa
-
Molecular Weight
Approximately 14 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)