Thioredoxin/TXN Protein, Human (His)

Thioredoxin/TXN Protein, Human (His) is a thiol-oxidoreductase enzyme which control cellular redox homeostasis.

Thioredoxins are small thiol-oxidoreductase enzymes that control cellular redox homeostasis^[1]. Human thioredoxin acts as a danger-associated molecular pattern (DAMP) on the immune system and is released upon stress from skin cells. Human thioredoxin leads to the release of IL-13 and IL-10 from human peripheral blood mononuclear cells^[2].

Measured by its ability to catalyze the reduction of insulin. The reaction leads to precipitation, which can be measured by absorbance at 650 nm. The specific activity is 0.5-3.07 A650/min/mg.

Human

E. coli

N-6*His

P10599 (V2-V105)

7295  [NCBI]

Full Length of Mature Protein

VKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 1 mM EDTA, 2 mM DTT, pH 7.2 or 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1.0 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Léveillard T, et al. Cell Signaling with Extracellular Thioredoxin and Thioredoxin-Like Proteins: Insight into Their Mechanisms of Action. Oxid Med Cell Longev. 2017;2017:8475125.  [Content Brief]

  [2]. Roesner LM, et al. Human thioredoxin, a damage-associated molecular pattern and Malassezia-crossreactive autoallergen, modulates immune responses via the C-type lectin receptors Dectin-1 and Dectin-2. Sci Rep. 2019 Aug 1;9(1):11210.  [Content Brief]