1. Recombinant Proteins
  2. Receptor Proteins
  3. Thioredoxin/TXN Protein, Human (His)

Thioredoxin/TXN Protein, Human (His)

Cat. No.: HY-P7422
Handling Instructions

Thioredoxin/TXN Protein, Human (His) is a thiol-oxidoreductase enzyme which control cellular redox homeostasis.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $50 In-stock
Estimated Time of Arrival: December 31
50 μg $150 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Thioredoxin/TXN Protein, Human (His) Featured Recommendations:

Top Publications Citing Use of Products

Thioredoxin/TXN Protein, Human (His) Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Human

Source

E. coli

Tag

N-His

Accession

P10599 (V2-V105)

Gene ID

7295

Synonyms
rHuThioredoxin/TXN, His; Trx; ADF; TRX1
AA Sequence

HHHHHHMVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Molecular Weight

Approximately 13.9 kDa

Biological Activity
Its ability to catalyze the reduction of insuline by precipitation reaction measured by absorbance at 650 nm and the specific activity is 0.5 Abs/min/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM PB, 1 mM EDTA, 2 mM DTT, pH 7.2.

Endotoxin Level

<1.0 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Thioredoxins are small thiol-oxidoreductase enzymes that control cellular redox homeostasis[1]. Human thioredoxin acts as a danger-associated molecular pattern (DAMP) on the immune system and is released upon stress from skin cells. Human thioredoxin leads to the release of IL-13 and IL-10 from human peripheral blood mononuclear cells[2].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Thioredoxin/TXN Protein, Human (His)
Cat. No.:
HY-P7422
Quantity:
MCE Japan Authorized Agent: