TRGC2 Protein, Human (HEK293, His)
TRGC2 Protein, Human (HEK293, His) is the recombinant human-derived TRGC2 protein, expressed by HEK293, with C-His tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
TRGC2 Protein, Human (HEK293, His) is the recombinant human-derived TRGC2 protein, expressed by HEK293, with C-His tag.
Background
TRGC2 is the constant region of the T cell receptor (TR) gamma chain, involved in antigen recognition. Gamma-delta TRs recognize a variety of self and foreign non-peptide antigens, often expressed at epithelial boundaries between the host and external environment, including endogenous lipids presented by MH-like protein CD1D and phosphoantigens presented by butyrophilin-like molecule BTN3A1. Upon antigen recognition, TRGC2 triggers rapid, innate-like immune responses for pathogen clearance and tissue repair. Binding of the gamma-delta TR complex to antigen induces phosphorylation of immunoreceptor tyrosine-based activation motifs (ITAMs) in CD3 chains by LCK and FYN kinases, recruiting and activating ZAP70, which phosphorylates scaffolding proteins LCP2 and LAT. This leads to the formation of a supramolecular signalosome that recruits phospholipase PLCG1, resulting in calcium mobilization and ERK activation, ultimately driving T cell expansion and differentiation into effector cells. Gamma-delta TRs are generated through somatic rearrangement of a limited repertoire of variable (V), diversity (D), and joining (J) genes, with diversity enhanced by tandem D gene rearrangement, utilization of all three reading frames, and exonuclease trimming plus random nucleotide (N) region additions during V-(D)-J recombination.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
P03986 (D1-A154)
-
Gene ID/
-
Molecular Construction
-
N-term
-
TRGC2 (D1-A154)
Accession # P03986-1 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
TRGC2; TCRGC2; T cell receptor gamma constant 2; T-Cell Receptor, Gamma, Constant Region C2; TRGC2(3X); TRGC2(2X)
-
AA Sequence
DKQLDADVSPKPTIFLPSIAETKLQKAGTYLCLLEKFFPDIIKIHWQEKKSNTILGSQEGNTMKTNDTYMKFSWLTVPEESLDKEHRCIVRHENNKNGIDQEIIFPPIKTDVTTVDPKYNYSKDANDVITMDPKDNWSKDANDTLLLQLTNTSA
-
Predicted Molecular Mass
19.5 kDa
-
Molecular Weight
Approximately 30-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)