Copy Link Print Information

UbcH6/UBE2E1 Protein, Human (sf9)

Customer Review

Based on 1 Customer Validation

The UbcH6/UBE2E1 protein is an important ubiquitination component that acts as an E2 ubiquitin-conjugating enzyme, accepting ubiquitin in the E1 complex and catalyzing its covalent attachment to proteins. It is versatile and also facilitates covalent attachment of ISG15, playing a role in a variety of ubiquitin-like modifications. UbcH6/UBE2E1 Protein, Human (sf9) is the recombinant human-derived UbcH6/UBE2E1 protein, expressed by sf9 insect cells , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • UbcH6/UBE2E1 Protein, Human (sf9) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The UbcH6/UBE2E1 protein is an important ubiquitination component that acts as an E2 ubiquitin-conjugating enzyme, accepting ubiquitin in the E1 complex and catalyzing its covalent attachment to proteins. It is versatile and also facilitates covalent attachment of ISG15, playing a role in a variety of ubiquitin-like modifications. UbcH6/UBE2E1 Protein, Human (sf9) is the recombinant human-derived UbcH6/UBE2E1 protein, expressed by sf9 insect cells , with tag free.

Background

UbcH6/UBE2E1, a pivotal component of the ubiquitination machinery, functions as an E2 ubiquitin-conjugating enzyme by accepting ubiquitin from the E1 complex and catalyzing its covalent attachment to other proteins. Notably versatile, this enzyme also facilitates the covalent attachment of ISG15 to other proteins, highlighting its role in diverse ubiquitin-like modifications. Beyond conventional ubiquitination, UbcH6/UBE2E1 plays a crucial role in the selective degradation of short-lived and abnormal proteins, contributing to cellular quality control mechanisms. Furthermore, in vitro studies demonstrate its ability to catalyze 'Lys-48'-linked polyubiquitination, underscoring its involvement in the regulation of protein stability and turnover.

Verified Bioactivity

The ubiquitin conjugating activity of UB2E1 was validated through its ability to catalyse the generation of polyubiquitin chains in the presence of the E1 activating enzyme UBE1 and Bodipy-ubiquitin. Incubation of UB2E1 for 60 minutes at 37℃ in the presence of Bodipy-ubiquitin, UBE1 and ATP was compared alongside two control reactions with either ATP or UB2E1 excluded from the reaction. Ubiquitin conjugates were identified by the migration of the Bodipy-ubiquitin band and these were observed only in the presence of ATP and UB2E1.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag Tag Free
  • Accession

    P51965 (S2-T193)

  • Gene ID
    7324
  • Molecular Construction
    • N-term
    • UbcH6 (S2-T193)
      Accession # P51965
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    UBE2E1; Ubiquitin Conjugating Enzyme E2 E1; UbcH6; Ubiquitin-Conjugating Enzyme E2E 1 (Homologous To Yeast UBC4/5); Ubiquitin-Conjugating Enzyme E2E 1 (UBC4/5 Homolog,Yeast); (E3-Independent) E2 Ubiquitin-Conjugating Enzyme E1; Ubiquitin-Conjugating Enzym

  • AA Sequence

    SDDDSRASTSSSSSSSSNQQTEKETNTPKKKESKVSMSKNSKLLSTSAKRIQKELADITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 7.5, 200 mM NaCl, 5% glycerol, 1 mM DTT.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • UbcH6/UBE2E1 Protein, Human (sf9) Product Image
    1/16
  • UbcH6/UBE2E1 Protein, Human (sf9) Product Image