UbcH6/UBE2E1 Protein, Human (sf9)

The UbcH6/UBE2E1 protein is an important ubiquitination component that acts as an E2 ubiquitin-conjugating enzyme, accepting ubiquitin in the E1 complex and catalyzing its covalent attachment to proteins. It is versatile and also facilitates covalent attachment of ISG15, playing a role in a variety of ubiquitin-like modifications. UbcH6/UBE2E1 Protein, Human (sf9) is the recombinant human-derived UbcH6/UBE2E1 protein, expressed by sf9 insect cells , with tag free.

UbcH6/UBE2E1, a pivotal component of the ubiquitination machinery, functions as an E2 ubiquitin-conjugating enzyme by accepting ubiquitin from the E1 complex and catalyzing its covalent attachment to other proteins. Notably versatile, this enzyme also facilitates the covalent attachment of ISG15 to other proteins, highlighting its role in diverse ubiquitin-like modifications. Beyond conventional ubiquitination, UbcH6/UBE2E1 plays a crucial role in the selective degradation of short-lived and abnormal proteins, contributing to cellular quality control mechanisms. Furthermore, in vitro studies demonstrate its ability to catalyze 'Lys-48'-linked polyubiquitination, underscoring its involvement in the regulation of protein stability and turnover.

The ubiquitin conjugating activity of UB2E1 was validated through its ability to catalyse the generation of polyubiquitin chains in the presence of the E1 activating enzyme UBE1 and Bodipy-ubiquitin. Incubation of UB2E1 for 60 minutes at 37℃ in the presence of Bodipy-ubiquitin, UBE1 and ATP was compared alongside two control reactions with either ATP or UB2E1 excluded from the reaction. Ubiquitin conjugates were identified by the migration of the Bodipy-ubiquitin band and these were observed only in the presence of ATP and UB2E1.

Human

Sf9 insect cells

Tag Free

P51965 (S2-T193)

7324

Full Length of Mature Protein

SDDDSRASTSSSSSSSSNQQTEKETNTPKKKESKVSMSKNSKLLSTSAKRIQKELADITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT

≥ 90%, as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 7.5, 200 mM NaCl, 5% glycerol, 1 mM DTT.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

Please use rapid thawing with running water to thaw the protein.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.