UBE2G2 Protein, Human (GST)
Based on 1 Customer Validation
The UBE2G2 protein is an important ubiquitination component that accepts ubiquitin in the E1 complex, catalyzes its covalent attachment to various proteins, and preferentially performs "Lys-48"-linked polyubiquitination. Its specificity in shaping ubiquitin chains emphasizes its role in cellular processes. UBE2G2 Protein, Human (GST) is the recombinant human-derived UBE2G2 protein, expressed by E. coli , with N-GST labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The UBE2G2 protein is an important ubiquitination component that accepts ubiquitin in the E1 complex, catalyzes its covalent attachment to various proteins, and preferentially performs "Lys-48"-linked polyubiquitination. Its specificity in shaping ubiquitin chains emphasizes its role in cellular processes. UBE2G2 Protein, Human (GST) is the recombinant human-derived UBE2G2 protein, expressed by E. coli , with N-GST labeled tag.
Background
UBE2G2, a crucial component in the ubiquitination machinery, plays a pivotal role in the cellular process by accepting ubiquitin from the E1 complex and catalyzing its covalent attachment to various proteins. In vitro, UBE2G2 demonstrates a specific catalytic preference for 'Lys-48'-linked polyubiquitination, highlighting its involvement in shaping ubiquitin chains with specific linkages. Notably, UBE2G2 is intricately associated with endoplasmic reticulum-associated degradation (ERAD), underlining its significance in maintaining cellular homeostasis by regulating protein turnover. Furthermore, UBE2G2 is indispensable for sterol-induced ubiquitination of 3-hydroxy-3-methylglutaryl coenzyme A reductase, facilitating its subsequent proteasomal degradation.
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-GST
-
Accession
P60604 (M1-L165)
-
Molecular Construction
-
N-term
-
GST
-
UBE2G2 (M1-L165)
Accession # P60604 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
UBE2G2; Ubiquitin Conjugating Enzyme E2 G2; UBC7; Ubiquitin-Conjugating Enzyme E2G 2 (Homologous To Yeast UBC7); Ubiquitin-Conjugating Enzyme E2G 2 (UBC7 Homolog,Yeast); Ubiquitin-Conjugating Enzyme E2 G2; E2 Ubiquitin-Conjugating Enzyme G2; Ubiquitin Car
-
AA Sequence
MAGTALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDASKMWRDDREQFYKIAKQIVQKSLGL
-
Predicted Molecular Mass
45 kDa
-
Molecular Weight
Approximately 43 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 50 mM HEPES, 150 mM NaCl, 2 mM DTT, 10% glycerol, pH 7.5.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
