2. Recombinant Proteins
  3. Others
  4. ULBP1/RAET1I Protein, Mouse (HEK293, His)

ULBP1/RAET1I Protein, Mouse (HEK293, His)

Cat. No.: HY-P71415
Handling Instructions

UL16 binding protein 1 (Ulbp1) is a membrane ligand of natural killer group 2, member D (NKG2D) which activates immune system on NK cells and T cells. Binding of Ulbp1 to NKG2D leads to activation of JAK2, STAT5, ERK and PI3K/Akt pathways, positive regulating immune response, interferon-gamma production and leukocyte activation. The effect of Ulbp1 can be inhibited by binding to UL16. ULBP1/RAET1I Protein, Mouse (HEK293, His) is the recombinant mouse-derived ULBP1/RAET1I protein, expressed by HEK293, with C-6*His labeled tag. The total length of ULBP1/RAET1I Protein, Mouse (HEK293, His) is 186 a.a., with molecular weight of 30-40 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

UL16 binding protein 1 (Ulbp1) is a membrane ligand of natural killer group 2, member D (NKG2D) which activates immune system on NK cells and T cells. Binding of Ulbp1 to NKG2D leads to activation of JAK2, STAT5, ERK and PI3K/Akt pathways, positive regulating immune response, interferon-gamma production and leukocyte activation. The effect of Ulbp1 can be inhibited by binding to UL16. ULBP1/RAET1I Protein, Mouse (HEK293, His) is the recombinant mouse-derived ULBP1/RAET1I protein, expressed by HEK293, with C-6*His labeled tag. The total length of ULBP1/RAET1I Protein, Mouse (HEK293, His) is 186 a.a., with molecular weight of 30-40 kDa.
Background

UL16 binding protein 1 (Ulbp1) is a membrane ligand of natural killer group 2, member D (NKG2D), an immune system-activating receptor on NK cells and T-cells. Binding of Ulbp1 to NKG2D leads to activation of several signal transduction pathways, including those of JAK2, STAT5, ERK and PI3K/Akt. Ulbp1 is involved in positive regulation of immune response, interferon-gamma production and leukocyte activation. Also, in cytomegalovirus-infected cells, Ulbp1 binds the UL16 glycoprotein and is prevented from activating the immune system[1][2].
Species

Mouse
Source

HEK293
Tag

C-6*His
Accession

Q8HWA3 (P26-T211)
Gene ID

77777  [NCBI]
Molecular Construction
N-term
ULBP1 (P26-T211)
Accession # Q8HWA3
6*His
C-term
Synonyms
ULBP1; RAET1I; NKG2DL1
AA Sequence

PRIEETASLCNIYKVNRSESGQHSHEVQGLLNRQPLFVYKDKKCHAIGAHRNSMNATKICEKEVDTLKDGIDIFKGLLLHIVQETNTTGKPLTLQAEVCGQYEVDKHFTGYAIVSLNGKNIFRVDTSTGNWTQLDHEFEKFIEMCKEDKVLAAFLKKTTEGDCRTWLDELMLHWKEHLEPAGSFST

Molecular Weight

30-40 kDa
Purity

Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

ULBP1/RAET1I Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ULBP1/RAET1I Protein, Mouse (HEK293, His)
Cat. No.:
HY-P71415
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.