ULBP1/RAET1I Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
UL16 binding protein 1 (Ulbp1) is a membrane ligand of natural killer group 2, member D (NKG2D) which activates immune system on NK cells and T cells. Binding of Ulbp1 to NKG2D leads to activation of JAK2, STAT5, ERK and PI3K/Akt pathways, positive regulating immune response, interferon-gamma production and leukocyte activation. The effect of Ulbp1 can be inhibited by binding to UL16. ULBP1/RAET1I Protein, Mouse (HEK293, His) is the recombinant mouse-derived ULBP1/RAET1I protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
UL16 binding protein 1 (Ulbp1) is a membrane ligand of natural killer group 2, member D (NKG2D) which activates immune system on NK cells and T cells. Binding of Ulbp1 to NKG2D leads to activation of JAK2, STAT5, ERK and PI3K/Akt pathways, positive regulating immune response, interferon-gamma production and leukocyte activation. The effect of Ulbp1 can be inhibited by binding to UL16. ULBP1/RAET1I Protein, Mouse (HEK293, His) is the recombinant mouse-derived ULBP1/RAET1I protein, expressed by HEK293 , with C-6*His labeled tag.
Background
UL16 binding protein 1 (Ulbp1) is a membrane ligand of natural killer group 2, member D (NKG2D), an immune system-activating receptor on NK cells and T-cells. Binding of Ulbp1 to NKG2D leads to activation of several signal transduction pathways, including those of JAK2, STAT5, ERK and PI3K/Akt. Ulbp1 is involved in positive regulation of immune response, interferon-gamma production and leukocyte activation. Also, in cytomegalovirus-infected cells, Ulbp1 binds the UL16 glycoprotein and is prevented from activating the immune system[1][2].
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
Q8HWA3 (P26-T211)
-
Molecular Construction
-
N-term
-
ULBP1 (P26-T211)
Accession # Q8HWA3 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
Ulbp1; UL16 binding protein 1; N2DL1; ALCAN-Beta; Alcan-Beta; N2DL-1; NKG2DL1; NKG2D Ligand 1; UL16-Binding Protein 1; Retinoic Acid Early Transcript 1I ; RAET1I
-
AA Sequence
PRIEETASLCNIYKVNRSESGQHSHEVQGLLNRQPLFVYKDKKCHAIGAHRNSMNATKICEKEVDTLKDGIDIFKGLLLHIVQETNTTGKPLTLQAEVCGQYEVDKHFTGYAIVSLNGKNIFRVDTSTGNWTQLDHEFEKFIEMCKEDKVLAAFLKKTTEGDCRTWLDELMLHWKEHLEPAGSFST
-
Predicted Molecular Mass
22.3 kDa
-
Molecular Weight
Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
