Vaspin Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

Vaspin is an adipokine that regulates adipogenesis, metabolism, and inflammation by binding to the chemokine receptors CMKLR1 and CMKLR2. It mainly regulates adipocyte differentiation and affects lipid and glucose metabolism genes. Vaspin Protein, Human (HEK293, His) is the recombinant human-derived Vaspin protein, expressed by HEK293 , with C-10*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Vaspin is an adipokine that regulates adipogenesis, metabolism, and inflammation by binding to the chemokine receptors CMKLR1 and CMKLR2. It mainly regulates adipocyte differentiation and affects lipid and glucose metabolism genes. Vaspin Protein, Human (HEK293, His) is the recombinant human-derived Vaspin protein, expressed by HEK293 , with C-10*His labeled tag.

Background

Chemerin/RARRES2, an adipocyte-secreted protein (adipokine), orchestrates a multifaceted impact on adipogenesis, metabolism, and inflammation by activating the chemokine-like receptor 1 (CMKLR1) and also serving as a ligand for CMKLR2. While it can bind to C-C chemokine receptor-like 2 (CCRL2) with lower affinity, its primary role involves positively regulating adipocyte differentiation and influencing the expression of genes associated with lipid and glucose metabolism. Furthermore, Chemerin/RARRES2 plays a pivotal role in angiogenesis, essential for white adipose tissue expansion. As a pro-inflammatory adipokine, it amplifies the secretion of pro-inflammatory and prodiabetic adipokines, contributing to impaired metabolic function and systemic effects such as altered insulin sensitivity, disrupted glucose and lipid metabolism, and compromised vascular function in various tissues. Its enzymatic cleavage by different proteases can confer both pro- and anti-inflammatory properties. Acting as a chemotactic factor, it attracts leukocyte populations expressing CMKLR1, including plasmacytoid dendritic cells, myeloid dendritic cells, macrophages, and natural killer cells. Chemerin/RARRES2 also exhibits an anti-inflammatory role by inhibiting TNF/TNFA-induced VCAM1 expression and monocyte adhesion in vascular endothelial cells. This effect is mediated through the inhibition of NF-kappa-B and CRK/p38 activation, involving stimulation of AKT1/NOS3 signaling and nitric oxide production. This dual role in inflammation and metabolism suggests a potential link between chronic inflammation and obesity-related disorders, such as type 2 diabetes and cardiovascular disease. Additionally, Chemerin/RARRES2 demonstrates antimicrobial function in the skin.

Verified Bioactivity

Measured by its ability to inhibit KLK7 cleavage 10 μM Mca-RPKPVE-Nval-WRK(Dnp)-NH2(HY-P2185A ) that incubate at 37°C for 2 hours. The IC50 value is 11.04 nM.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-10*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Vaspin (L21-K414)
      Accession # Q8IW75
    • 10*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    SERPINA12; Serine (Or Cysteine) Proteinase Inhibitor, Clade A (Alpha-1 Antiproteinase, Antitrypsin), Member 12; Serpin Family A Member 12; Serpin Peptidase Inhibitor, Clade A (Alpha-1 Antiproteinase, Antitrypsin), Member 12; Vaspin; Serpin A12; OL-64; Vis

  • AA Sequence

    LKPSFSPRNYKALSEVQGWKQRMAAKELARQNMDLGFKLLKKLAFYNPGRNIFLSPLSISTAFSMLCLGAQDSTLDEIKQGFNFRKMPEKDLHEGFHYIIHELTQKTQDLKLSIGNTLFIDQRLQPQRKFLEDAKNFYSAETILTNFQNLEMAQKQINDFISQKTHGKINNLIENIDPGTVMLLANYIFFRARWKHEFDPNVTKEEDFFLEKNSSVKVPMMFRSGIYQVGYDDKLSCTILEIPYQKNITAIFILPDEGKLKHLEKGLQVDTFSRWKTLLSRRVVDVSVPRLHMTGTFDLKKTLSYIGVSKIFEEHGDLTKIAPHRSLKVGEAVHKAELKMDERGTEGAAGTGAQTLPMETPLVVKIDKPYLLLIYSEKIPSVLFLGKIVNPIGK

  • Predicted Molecular Mass

    46.5 kDa

  • Molecular Weight

    Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00