VEGF-D Protein, Human (CHO)
Based on 1 Customer Validation
VEGF-D Protein, Human (CHO) is a regulator of both angiogenesis and lymphangiogenesis.
- Species: Human
- Source: CHO
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
VEGF-D Protein, Human (CHO) is a regulator of both angiogenesis and lymphangiogenesis.
VEGF-D, a powerful lymphangiogenic and angiogenic growth factor, is also a major regulator of chylomicron metabolism in mice[1]. Vascular endothelial growth factor D (VEGF-D) has important functions in lymphangiogenesis and angiogenesis. High plasma levels of VEGF-D have been associated with incidence of heart failure. The association of VEGF-D with atrial fibrillation (AF) and stroke is unclear and we hypothesised that VEGF-D could also be associated with incidence of AF and ischaemic stroke[2].
The ED50 is <1 μg/mL as measured by HUVEC cells.
Technical Parameters
-
Species Human
-
Source CHO
-
Tag Tag Free
-
Accession
O43915 (F89-R205)
-
Molecular Construction
-
N-term
-
VEGF-D (F89-R205)
Accession # O43915 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
VEGFD; Vascular Endothelial Growth Factor D; FIGF; VEGF‑D; C‑Fos Induced Growth Factor (Vascular Endothelial Growth Factor D); C‑Fos‑Induced Growth Factor
-
AA Sequence
FAATFYDIETLKVIDEEWQRTQCSPRETCVEVASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVPVKVANHTGCKCLPTAPRHPYSIIRR
-
Molecular Weight
Approximately 18-19 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Structure/Form
Homodimer
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS.
<0.2 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (262 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Tirronen A, et al. Deletion of Lymphangiogenic and Angiogenic Growth Factor VEGF-D Leads to Severe Hyperlipidemia and Delayed Clearance of Chylomicron Remnants. 2018 Oct;38(10):2327-2337. [Content Brief]
[2]. Berntsson J1, et al. Increased vascular endothelial growth factor D is associated with atrial fibrillation and ischaemic stroke. Heart. 2018 Oct 16. pii: heartjnl-2018-313684. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
