VEGF165 Protein, Human (HEK293, StrepⅡ, His)
VEGF165 Protein is a subtype of Vascular Endothelial Growth Factor A (VEGF-A). VEGF-A is a key member of the VEGF family of cytokines that can promote neovascularization and increase vascular permeability. VEGF165 Protein, Human (HEK293, Strep, His) is the recombinant human-derived VEGF165, expressed by HEK293, with Strep, His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
VEGF165 Protein is a subtype of Vascular Endothelial Growth Factor A (VEGF-A). VEGF-A is a key member of the VEGF family of cytokines that can promote neovascularization and increase vascular permeability. VEGF165 Protein, Human (HEK293, Strep, His) is the recombinant human-derived VEGF165, expressed by HEK293, with Strep, His labeled tag.
Background
VEGF165 is a subtype of Vascular Endothelial Growth Factor A (VEGF-A). VEGF-A is a key member of the VEGF family of cytokines, along with VEGF-B, -C, -D, and PGF. VEGF-A participates in angiogenesis, vasculogenesis, and endothelial cell growth, inducing endothelial cell proliferation, promoting cell migration, inhibiting cell apoptosis, and inducing vascular permeability. VEGF-A binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. VEGF-A also binds to NRP1 initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including for the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development. VEGF165 may be secreted by tumour cells, binds with high affinity to VEGFR-1 and VEGFR-2 receptors[1][2][3][4][5][6][7][8].
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-StrepⅡ;His
-
Accession
P15692-4 (A27-R191)
-
Gene ID7422
-
Protein Length
Full Length of Isoform-4
-
Synonyms
VEGFA; Vascular Endothelial Growth Factor A; VEGF; VPF; Vascular Permeability Factor; Vascular Endothelial Growth Factor A, Long Form; VEGF-A; L-VEGF; Vascular Endothelial Growth Factor A121; Vascular Endothelial Growth Factor A165; Vascular Endothelial G
-
AA Sequence
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
-
Predicted Molecular Mass
22.2 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
References
[1]. Vempati P, et al. Extracellular regulation of VEGF: isoforms, proteolysis, and vascular patterning. Cytokine Growth Factor Rev. 2014 Feb;25(1):1-19. [Content Brief]
[2]. Murphy JF, et al. Vascular endothelial growth factor induces cyclooxygenase-dependent proliferation of endothelial cells via the VEGF-2 receptor. FASEB J. 2001 Jul;15(9):1667-9. [Content Brief]
[3]. Dixelius J, et al. Minimal active domain and mechanism of action of the angiogenesis inhibitor histidine-rich glycoprotein. Cancer Res. 2006 Feb 15;66(4):2089-97. [Content Brief]
[4]. Glorioso N, et al. Association of ATP1A1 and dear single-nucleotide polymorphism haplotypes with essential hypertension: sex-specific and haplotype-specific effects. Circ Res. 2007 May 25;100(10):1522-9. [Content Brief]
[5]. Khayati F, et al. EMMPRIN/CD147 is a novel coreceptor of VEGFR-2 mediating its activation by VEGF. Oncotarget. 2015;6(12):9766-80. [Content Brief]
[7]. Ferrara N, et al. Molecular and biological properties of the vascular endothelial growth factor family of proteins. Endocr Rev. 1992 Feb;13(1):18-32. [Content Brief]
[8]. Terman BI, et al. Identification of the KDR tyrosine kinase as a receptor for vascular endothelial cell growth factor. Biochem Biophys Res Commun. 1992 Sep 30;187(3):1579-86. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
