VEGF164 Protein, Rat (CHO)

3 Cited Publications
Customer Review

Based on 3 publication(s) in Google Scholar

VEGF164 Protein, Rat (CHO) is a potent mediator of angiogenesis and binds the semaphorin receptor, neuropilin1.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: CHO
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

VEGF164 Protein, Rat (CHO) is a potent mediator of angiogenesis and binds the semaphorin receptor, neuropilin1.

Background

Vascular endothelial growth factor (VEGF or VEGFA) is a potent mediator of both angiogenesis and vasculogenesis in the fetus and adult. It is a member of the PDGF family that is characterized by the presence of eight conserved cysteine residues and a cystine knot structure[1]. VEGF164 appears to be the most abundant and potent isoform, followed by VEGF121 and VEGF189[1][2]. VEGF164 binds the semaphorin receptor, Neuropilin1 and promotes complex formation with VEGF R2[3].

Verified Bioactivity

The ED50 is <4 ng/mL as measured by HUVEC cells, corresponding to a specific activity of >2.5 × 105 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells. The ED50 for this effect is 3.56 ng/mL, corresponding to a specific activity is 2.81×105 units/mg.

Technical Parameters

  • Species Rat
  • Source CHO
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • VEGF164 (A27-R190)
      Accession # P16612-2
    • C-term
  • Protein Length

    Full Length of Isoform-2

  • Synonyms

    VEGFA; Vascular Endothelial Growth Factor A; VEGF; VPF; Vascular Permeability Factor; Vascular Endothelial Growth Factor A, Long Form; VEGF-A; L-VEGF; Vascular Endothelial Growth Factor A121; Vascular Endothelial Growth Factor A165; Vascular Endothelial G

  • AA Sequence

    APTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

  • Predicted Molecular Mass

    19.2 kDa

  • Molecular Weight

    Approximately 35-48 kDa, based on SDS-PAGE under non reducing (N) conditions.

  • Glycosylation

    Yes

  • Structure/Form

    Homodimer

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00