Copy Link Print Information

VEGF164 Protein, Rat (CHO)

3 Cited Publications
Customer Review

Based on 3 publication(s) in Google Scholar

VEGF164 Protein, Rat (CHO) is a potent mediator of angiogenesis and binds the semaphorin receptor, neuropilin1.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: CHO
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for VEGF164 Protein, Rat (CHO)
  • Experimental Validation Results for VEGF164 Protein, Rat (CHO)
  • VEGF164 Protein, Rat (CHO) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

VEGF164 Protein, Rat (CHO) is a potent mediator of angiogenesis and binds the semaphorin receptor, neuropilin1.

Background

Vascular endothelial growth factor (VEGF or VEGFA) is a potent mediator of both angiogenesis and vasculogenesis in the fetus and adult. It is a member of the PDGF family that is characterized by the presence of eight conserved cysteine residues and a cystine knot structure[1]. VEGF164 appears to be the most abundant and potent isoform, followed by VEGF121 and VEGF189[1][2]. VEGF164 binds the semaphorin receptor, Neuropilin1 and promotes complex formation with VEGF R2[3].

Verified Bioactivity

The ED50 is <4 ng/mL as measured by HUVEC cells, corresponding to a specific activity of >2.5 × 105 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells. The ED50 for this effect is 3.56 ng/mL, corresponding to a specific activity is 2.81×105 units/mg.

Technical Parameters

  • Species Rat
  • Source CHO
  • Tag Tag Free
  • Accession

    P16612-2 (A27-R190)

  • Gene ID
    83785  [NCBI]
  • Molecular Construction
    • N-term
    • VEGF164 (A27-R190)
      Accession # P16612-2
    • C-term
  • Protein Length

    Full Length of Isoform-2

  • Synonyms

    VEGFA; Vascular Endothelial Growth Factor A; VEGF; VPF; Vascular Permeability Factor; Vascular Endothelial Growth Factor A, Long Form; VEGF-A; L-VEGF; Vascular Endothelial Growth Factor A121; Vascular Endothelial Growth Factor A165; Vascular Endothelial G

  • AA Sequence

    APTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

  • Predicted Molecular Mass

    19.2 kDa

  • Molecular Weight

    Approximately 35-48 kDa, based on SDS-PAGE under non reducing (N) conditions.

  • Glycosylation

    Yes

  • Structure/Form

    Homodimer

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Robinson CJ, et al. The splice variants of vascular endothelial growth factor (VEGF) and their receptors. J Cell Sci. 2001 Mar;114(Pt 5):853-65. [Content Brief]

[2]. Byrne AM, et al. Angiogenic and cell survival functions of vascular endothelial growth factor (VEGF). J Cell Mol Med. 2005 Oct-Dec;9(4):777-94. [Content Brief]

[3]. Qi Pan, et al. Neuropilin-1 Binds to VEGF121 and Regulates Endothelial Cell Migration and Sprouting. The Journal of Biological Chemistry 282, 24049-24056.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells. The ED50 for this effect is 3.56 ng/mL, corresponding to a specific activity is 2.81×105 units/mg.

  • VEGF164 Protein, Rat (CHO) Product Image
    1/16
  • Experimental Validation Results for VEGF164 Protein, Rat (CHO)
  • Experimental Validation Results for VEGF164 Protein, Rat (CHO)
  • VEGF164 Protein, Rat (CHO) Product Image